Human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF)


  • Specification
  • Drug Information
  • Related Products
Cat#:  THP-0003
Product Name:  Human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF)
Description:  The product is a human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
Formula:  C639H1006N168O196S8
Sequences:  APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Species:  Human
Source:  Yeast
CAS No. :  123774-72-1
Molecular Weight:  14434.5 Da
Synonyms:  GM-CSF
Drug name:  Sargramostim
Applications:  For the treatment of cancer and bone marrow transplant.
Examples of Clinical Use:  Cancer and bone marrow transplant
Pharmacodynamics :  The product is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy an recovering from acut myelogenous leukemia, GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of action:  Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor (GM-CSF-R-alpha or CSF2R) which stimulates a JAK2 STAT1/STAT3 signal transduction pathway. This leads to the production of hemopoietic cells and neutrophils.
Affected organisms:  Humans and other mammals
Targets:  Target 1. Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; Target 2. Interleukin-3 receptor subunit alpha; Target 3. Cytokine receptor common subunit beta; Target 4. Syndecan-2; Target 5. Bone marrow proteoglycan
Catalog# Product Name Inquiry
THP-0004 Human cytokine granulocyte-macrophage colony stimulating factor (GM-CSF) Inquiry
THP-0005 Recombinant thyroid stimulating hormone Inquiry
THP-0006 Recombinant human VEGFRs, Fc tag, Aflibercept Inquiry
THP-0007 Recombinant Modified Human interleukin-2, Aldesleukin Inquiry
THP-0008 Luteinizing hormone-releasing hormone (LHRH) Inquiry


For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
Search

USA

Enter your email here to subscribe.

Follow us on

Easy access to products and services you need from our library via powerful searching tools

Copyright © 2007 - 2021 Creative BioMart. All Rights Reserved.