Inquiry Basket

Sargramostim; GM-CSF

Cat# : THP-0003

Product Datasheets COA :

Catalog#	Product Name	Availability	Size	Price	Qty
THP-0003	Sargramostim; GM-CSF	April 27, 2024	250ug	$2,998.00
Add to Cart Online Order Request a Bulk Order

Related Products

Cat#:	THP-0003
Product Name:	Sargramostim; GM-CSF
Description:	A modified form of recombinant human granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein.
Sequences:	APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Species:	Human
Molecular Weight:	14434.5 Da
Source:	Yeast
Purity:	>99% by SDS-Page and HPLC analysis
Cas No:	123774-72-1
Formula:	C639H1006N168O196S8
Endotoxin Level:	<0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:	500 ug/1mL

Catalog#	Product Name	Size	Price	Inquiry
THP-1108	Recombinant stabilized RSV B prefusion F antigen			Inquiry
THP-1102	Cipaglucosidase alfa; Recombinant Human acid alpha-glucosidase			Inquiry
THP-1101	Pegunigalsidase alfa; Recombinant Human α-galactosidase-A			Inquiry
THP-1104	Efanesoctocog alfa; Recombinant DNA-derived, Factor VIII; F8			Inquiry
THP-1100	Velmanase alfa;Recombinant Human Lysosomal alpha-mannosidase			Inquiry
THP-0067	Recombinant Human Erythropoietin	1 vial	$3,998.00	Add to Cart Order
THP-0052	Recombinant Human F8/Antihemophilic factor	100IU	$698.00	Add to Cart Order
THP-0071	Filgrastim, Recombinant human GCSF	1 vial	$3,998.00	Add to Cart Order
THP-9328	Recombinant Human Hyaluronidase PH20, Fc-tagged	1KU	$398	Add to Cart Order
VAC-0413	Recombinant Hepatitis E Vaccine (E. coli)			Inquiry

For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Pharmaceutical Application:	Sargramostim
Applications:	For the treatment of cancer and bone marrow transplant.
Examples of Clinical Use:	Cancer and bone marrow transplant
Pharmacodynamics:	The product is used in the treatment of bone marrow transplant recipients or those exposed to chemotherapy an recovering from acut myelogenous leukemia, GM-CSF is a hematopoietic growth factor which stimulates the survival, clonal expansion (proliferation) and differentiation of hematopoietic progenitor cells. GM-CSF is also capable of activating mature granulocytes and macrophages. After a bone marrow transplant or chemotherapy, patients have a reduced capacity to produce red and white blood cells. Supplementing them with external sources of GM-CSF helps bring the level of neutrophils back to normal so that they can better fight infections.
Mechanism of action:	Sargramostim binds to the Granulocyte-macrophage colony stimulating factor receptor (GM-CSF-R-alpha or CSF2R) which stimulates a JAK2 STAT1/STAT3 signal transduction pathway. This leads to the production of hemopoietic cells and neutrophils.
Affected organisms:	Humans and other mammals
Targets:	Target 1. Granulocyte-macrophage colony-stimulating factor receptor subunit alpha; Target 2. Interleukin-3 receptor subunit alpha; Target 3. Cytokine receptor common subunit beta; Target 4. Syndecan-2; Target 5. Bone marrow proteoglycan

Sargramostim; GM-CSF

Specification

Pharmaceutical Information

Related Products

Online Inquiry