0
Inquiry Basket
Quote

Recombinant Human Erythropoietin

Cat# : THP-0067

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0067 Recombinant Human Erythropoietin May 08, 2024 1 vial $3,998.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0067
Product Name:  Recombinant Human Erythropoietin
Description:  The product is a growth factor produced in the kidneys that stimulates the production of red blood cells. It works by promoting the division and differentiation of committed erythroid progenitors in the bone marrow. It is a 165-amino acid erythropoiesis-stimulating glycoprotein produced in cell culture using recombinant DNA technology. It has a molecular weight of approximately 30,400 daltons and is produced by mammalian cells into which the human growth factor gene has been introduced. The product contains the identical amino acid sequence of isolated natural product and has the same biological activity as the endogenous the product.
Sequences:  APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Species:  Human
Molecular Weight:  18396.1 Da
Source:  Mammalian cells
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  11096-26-7
Formula:  C815H1317N233O241S5
Endotoxin Level:  <0.001 EU per 1 μg of the protein by the LAL method
Biological Activity:  8000IU/0.8ml
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.