Cat# : THP-0102
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0102 | Belatacept, Recombinant human CTLA4 protein, Fc tagged | May 07, 2024 | 5mg | $1,000.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0102 |
Product Name: | Belatacept, Recombinant human CTLA4 protein, Fc tagged |
Description: | The product is a soluble fusion protein, which links the extracellular domain of human cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) to the modified Fc (hinge, CH2, and CH3 domains) portion of human immunoglobulin G1 (IgG1). Structurally, the product is a glycosylated fusion protein with a MALDI-MS molecular weight of 92,300 Da and it is a homodimer of two homologous polypeptide chains of 357 amino acids each. It is produced through recombinant DNA technology in mammalian CHO cells. The drug has activity as a selective co-stimulation modulator with inhibitory activity on T lymphocytes. |
Sequences: | MHVAQPAVVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Species: | Human |
Molecular Weight: | 92300.0 Da (with glycosylation) |
Source: | CHO |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 706808-37-9 |
Formula: | C3508H5440N922O1096S32 |
Endotoxin Level: | <0.001 EU per 1 μg by the LAL method |
Biological Activity: | 250mg |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.