0
Inquiry Basket
Quote

Belatacept, Recombinant human CTLA4 protein, Fc tagged

Cat# : THP-0102

Product Datasheets COA :
Catalog# Product Name Availability Size Price Qty
THP-0102 Belatacept, Recombinant human CTLA4 protein, Fc tagged May 05, 2024 5mg $1,000.00
Add to Cart Online Order Request a Bulk Order
Cat#:  THP-0102
Product Name:  Belatacept, Recombinant human CTLA4 protein, Fc tagged
Description:  The product is a soluble fusion protein, which links the extracellular domain of human cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) to the modified Fc (hinge, CH2, and CH3 domains) portion of human immunoglobulin G1 (IgG1). Structurally, the product is a glycosylated fusion protein with a MALDI-MS molecular weight of 92,300 Da and it is a homodimer of two homologous polypeptide chains of 357 amino acids each. It is produced through recombinant DNA technology in mammalian CHO cells. The drug has activity as a selective co-stimulation modulator with inhibitory activity on T lymphocytes.
Sequences:  MHVAQPAVVLASSRGIASFVCEYASPGKYTEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYEGIGNGTQIYVIDPEPCPDSDQEPKSSDKTHTSPPSPAPELLGGSSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Species:  Human
Molecular Weight:  92300.0 Da (with glycosylation)
Source:  CHO
Purity:  >99% by SDS-Page and HPLC analysis
Cas No:  706808-37-9
Formula:  C3508H5440N922O1096S32
Endotoxin Level:  <0.001 EU per 1 μg by the LAL method
Biological Activity:  250mg
For research use only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry

  • Size: 100ug 500ug 1mg 5mg 10mg 100mg 500mg 1g
  • Conjugation: None R-PE APC Biotin FITC Alexa Flour Others
CONTACT US

For more information on how our products could help advance your project, please contact us.

Contact Us

ENTER YOUR EMAIL HERE TO SUBSCRIBE.

Copyright © 2024 Creative BioMart. All Rights Reserved.