Cat# : THP-0047
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0047 | Ancestim, Recombinant human stem cell factor | May 13, 2024 | 1 vial | $3,998.00 |
|
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0047 |
Product Name: | Ancestim, Recombinant human stem cell factor |
Description: | The product is a non-glycosylated recombinant methionyl human stem cell factor. It is a 166 amino acid protein produced by E. coli with an amino acid sequence that is identical to the natural sequence predicted from human DNA sequence analysis, except for the addition of an N-terminal methionine. |
Sequences: | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA |
Species: | Human |
Molecular Weight: | 18540.0 Da (non-glycosylated) |
Source: | E.coli |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 163545-26-4 |
Formula: | C1662H2650N422O512S18 |
Endotoxin Level: | <0.001 EU per 1 μg of the peptide by the LAL method |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.