Cat# : THP-0006
Catalog# | Product Name | Availability | Size | Price | Qty |
---|---|---|---|---|---|
THP-0006 | Aflibercept; Recombinant human VEGFRs, Fc tag | June 01, 2024 | 100ug | $398.00 |
|
200ug | $698.00 |
|
|||
1mg | $2,998.00 |
|
|||
Add to Cart Online Order Request a Bulk Order |
Cat#: | THP-0006 |
Product Name: | Aflibercept; Recombinant human VEGFRs, Fc tag |
Description: | The product is a recombinant fusion protein that comprises of two main components: the vascular endothelial growth factor (VEGF) binding portions from the extracellular domains of human VEGF receptors 1 and 2 which is then fused to the Fc portion of human IgG1. Structurally, the product is a dimeric glycoprotein with a protein molecular weight of 96.9 kilo Daltons (kDa). It contains approximately 15% glycosylation to give a total molecular weight of 115 kDa. All five putative N-glycosylation sites on each polypeptide chain predicted by the primary sequence can be occupied with carbohydrate and exhibit some degree of chain heterogeneity, including heterogeneity in terminal sialic acid residues, except at the single unsialylated site associated with the Fc domain. |
Sequences: | SDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRSDQGLYTCAASSGLMTKKNSTFVRVHEKDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG |
Species: | Human |
Molecular Weight: | 115KDa (with glycosylation) |
Source: | CHO |
Purity: | >99% by SDS-Page and HPLC analysis |
Cas No: | 862111-32-8 |
Formula: | C4318H6788N1164O1304S32 |
Endotoxin Level: | <0.001 EU per 1 μg of the protein by the LAL method |
Biological Activity: | 40 mg/ml |
Storage: | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 2-8 °C for 1 week. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
For more information on how our products could help advance your project, please contact us.
ENTER YOUR EMAIL HERE TO SUBSCRIBE.
Copyright © 2024 Creative BioMart. All Rights Reserved.