"EIF3I" Related Products

Expand
Expand

Recombinant Human EIF3I protein, T7-tagged

Cat.No.: EIF3I-223H
Product Overview: Recombinant human EIF3I (325aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDN NEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHF GPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA
Purity: >90% by SDS-PAGE.
Applications: 1. May be used for in vitro TGFb1 mediated EMT regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF3I protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: EIF3I eukaryotic translation initiation factor 3, subunit I [ Homo sapiens ]
Official Symbol: EIF3I
Synonyms: EIF3I; eIF3 beta; eIF3 p36; eIF3i; TRIP 1; eIF-3-beta; predicted protein of HQ2242; TGFbeta receptor-interacting protein 1; TGF-beta receptor-interacting protein 1; TRIP1; EIF3S2; TRIP-1; PRO2242; eIF3-p36; eIF3-beta;
Gene ID: 8668
mRNA Refseq: NM_003757
Protein Refseq: NP_003748
MIM: 603911
UniProt ID: Q13347
Chromosome Location: 1p34.1
Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem;
Function: protein binding; contributes_to translation initiation factor activity; translation initiation factor activity; translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.