Recombinant Human EIF3I protein, T7-tagged

Cat.No. : EIF3I-223H
Product Overview : Recombinant human EIF3I (325aa) fused with T7 Tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : T7
Protein Length : 325 a.a.
Form : 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence : MASMTGGQQMGRGEFMKPILLQGHERSITQIKYNREGDLLFTVAKDPIVNVWYSVNGERLGTYMGHTGAVWCVDA DWDTKHVLTGSADNSCRLWDCETGKQLALLKTNSAVRTCGFDFGGNIIMFSTDKQMGYQCFVSFFDLRDPSQIDN NEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRDMTMFVTASKDN TAKLFDSTTLEHQKTFRTERPVNSAALSPNYDHVVLGGGQEAMDVTTTSTRIGKFEARFFHLAFEEEFGRVKGHF GPINSVAFHPDGKSYSSGGEDGYVRIHYFDPQYFEFEFEA
Purity : >90% by SDS-PAGE.
Applications : 1. May be used for in vitro TGFb1 mediated EMT regulation study with intracellular delivery of this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping EIF3I protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage : Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name EIF3I eukaryotic translation initiation factor 3, subunit I [ Homo sapiens ]
Official Symbol EIF3I
Synonyms EIF3I; eIF3 beta; eIF3 p36; eIF3i; TRIP 1; eIF-3-beta; predicted protein of HQ2242; TGFbeta receptor-interacting protein 1; TGF-beta receptor-interacting protein 1; TRIP1; EIF3S2; TRIP-1; PRO2242; eIF3-p36; eIF3-beta;
Gene ID 8668
mRNA Refseq NM_003757
Protein Refseq NP_003748
MIM 603911
UniProt ID Q13347
Chromosome Location 1p34.1
Pathway Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem; Formation of a pool of free 40S subunits, organism-specific biosystem; Formation of the ternary complex, and subsequently, the 43S complex, organism-specific biosystem; GTP hydrolysis and joining of the 60S ribosomal subunit, organism-specific biosystem; Gene Expression, organism-specific biosystem;
Function protein binding; contributes_to translation initiation factor activity; translation initiation factor activity; translation initiation factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF3I Products

Required fields are marked with *

My Review for All EIF3I Products

Required fields are marked with *

0
cart-icon