"FCRL4" Related Products

Expand

Recombinant Human FCRL4 protein, His-tagged

Cat.No.: FCRL4-920H
Product Overview: Recombinant Human FCRL4(20-387aa) fused with His tag was expressed in HEK293.
Description: This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein has four extracellular C2-type immunoglobulin domains, a transmembrane domain and a cytoplasmic domain that contains three immune-receptor tyrosine-based inhibitory motifs. This protein may play a role in the function of memory B-cells in the epithelia. Aberrations in the chromosomal region encoding this gene are associated with non-Hodgkin lymphoma and multiple myeloma
Source: HEK293
Species: Human
Tag: His
Form: 20mM Tris-HCl based buffer,pH8.0
Molecular Mass: 48.68kDa
Protein length: 20-387aa
AA Sequence: AHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHRHYWGEKLTLTPGNTLEVRE SGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLVLRCHRRRKEKLTAVKYTWN GNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSNFKIIKIQELFPHPELKATD SQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDWSTYPELQLPTVWRENSGSY WCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQAVEGEMLVLVCSVAEGTGDT TFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCTADNSYGPVQSMVLNVTVRE TPGNRDGL
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name: FCRL4 Fc receptor-like 4 [ Homo sapiens ]
Official Symbol: FCRL4
Synonyms: FCRL4; Fc receptor-like 4; Fc receptor-like protein 4; CD307d; FCRH4; IGFP2; IRTA1; hIFGP2; fcR-like protein 4; IFGP family protein 2; fc receptor homolog 4; immunoglobulin superfamily Fc receptor, gp42; immune receptor translocation-associated protein 1; immunoglobulin superfamily receptor translocation associated 1; MGC150522; MGC150523;
Gene ID: 83417
mRNA Refseq: NM_031282
Protein Refseq: NP_112572
MIM: 605876
UniProt ID: Q96PJ5
Chromosome Location: 1q21
Function: protein binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.