Recombinant Human GINS2 protein, T7-tagged
Cat.No. : | GINS2-153H |
Product Overview : | Recombinant human GINS2 ( 185aa ) protein fused with T7 Tag (17aa)at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | T7 |
Protein Length : | 185 a.a. |
Form : | 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol. |
AA Sequence : | MASMTGGQQMGRGEFGSMDAAEVEFLAEKELVTIIPNFSLDKIYLIGGDLGPFNPGLPVEVPLWLAINLKQRQKC RLLPPEWMDVEKLEKMRDHERKEETFTPMPSPYYMELTKLLLNHASDNIPKADEIRTLVKDMWDTRIAKLRVSAD SFVRQQEAHAKLDNLTLMEINTSGTFLTQALNHMYKLRTNLQPLESTQSQDF |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for mapping GINS2 protein – protein interaction assay.2. May be used as specific substrate protein for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. Potential biomarker protein for breast cancer diagnosis.4. May be used for specific antibody production. |
Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
Gene Name | GINS2 GINS complex subunit 2 (Psf2 homolog) [ Homo sapiens ] |
Official Symbol | GINS2 |
Synonyms | GINS2; GINS complex subunit 2 (Psf2 homolog); DNA replication complex GINS protein PSF2; Pfs2; PSF2; HSPC037; |
Gene ID | 51659 |
mRNA Refseq | NM_016095 |
Protein Refseq | NP_057179 |
MIM | 610609 |
UniProt ID | Q9Y248 |
Chromosome Location | 16q24.1 |
Pathway | Cell Cycle, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; DNA Replication, organism-specific biosystem; DNA strand elongation, organism-specific biosystem; GINS complex, organism-specific biosystem; S Phase, organism-specific biosystem; Synthesis of DNA, organism-specific biosystem; |
Function | protein binding; |
◆ Recombinant Proteins | ||
GINS2-6359M | Recombinant Mouse GINS2 Protein | +Inquiry |
Gins2-3210M | Recombinant Mouse Gins2 Protein, Myc/DDK-tagged | +Inquiry |
GINS2-3561M | Recombinant Mouse GINS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GINS2-3037Z | Recombinant Zebrafish GINS2 | +Inquiry |
GINS2-5264HF | Recombinant Full Length Human GINS2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GINS2-5933HCL | Recombinant Human GINS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GINS2 Products
Required fields are marked with *
My Review for All GINS2 Products
Required fields are marked with *