"SRD5A2" Related Products

Expand

Recombinant Human SRD5A2 protein

Cat.No.: SRD5A2-81H
Product Overview: Recombinant Human SRD5A2 was expressed in Wheat Germ.
Description: This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH).
Source: Wheat Germ
Species: Human
Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass: 28 Kd
AA Sequence: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSL FGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGV FLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLG LRAFHHHRFYLKMFEDYPKSRKALIPFIF
Applications: Antibody Production; Functional Study: Recommended usage only, not validated yet. Compound Screening: Recommended usage only, not validated yet.
Notes: Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ]
Official Symbol: SRD5A2
Synonyms: SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2; 3-oxo-5 alpha-steroid 4-dehydrogenase 2; MGC138457;
Gene ID: 6716
mRNA Refseq: NM_000348
Protein Refseq: NP_000339
MIM:
UniProt ID: P31213
Chromosome Location: 2p23.1
Pathway: Androgen biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem;
Function: 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.