Recombinant Human SRD5A2 protein
Cat.No. : | SRD5A2-81H |
Product Overview : | Recombinant Human SRD5A2 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result in male pseudohermaphroditism, specifically pseudovaginal perineoscrotal hypospadias (PPSH). |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 28 Kd |
AA Sequence : | MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPARAAWFLQELPSFAVPAGILARQPLSL FGPPGTVLLGLFCLHYFHRTFVYSLLNRGRPYPAILILRGTAFCTGNGVLQGYYLIYCAEYPDGWYTDIRFSLGV FLFILGMGINIHSDYILRQLRKPGEISYRIPQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLG LRAFHHHRFYLKMFEDYPKSRKALIPFIF |
Applications : | Antibody Production; Functional Study: Recommended usage only, not validated yet. Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SRD5A2 steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) [ Homo sapiens ] |
Official Symbol | SRD5A2 |
Synonyms | SRD5A2; steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2); 3-oxo-5-alpha-steroid 4-dehydrogenase 2; S5AR 2; SR type 2; 5 alpha-SR2; type II 5-alpha reductase; steroid 5-alpha-reductase 2; 3-oxo-5 alpha-steroid 4-dehydrogenase 2; MGC138457; |
Gene ID | 6716 |
mRNA Refseq | NM_000348 |
Protein Refseq | NP_000339 |
MIM | |
UniProt ID | P31213 |
Chromosome Location | 2p23.1 |
Pathway | Androgen biosynthesis, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Prostate cancer, organism-specific biosystem; Prostate cancer, conserved biosystem; Steroid hormone biosynthesis, organism-specific biosystem; |
Function | 3-oxo-5-alpha-steroid 4-dehydrogenase activity; sterol 5-alpha reductase activity; |
◆ Recombinant Proteins | ||
SRD5A2-15971M | Recombinant Mouse SRD5A2 Protein | +Inquiry |
SRD5a2-1240H | Recombinant Human SRD5a2 protein, His-GST-tagged | +Inquiry |
RFL30240HF | Recombinant Full Length Human 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 2(Srd5A2) Protein, His-Tagged | +Inquiry |
SRD5A2-2197H | Recombinant Human SRD5A2 protein(29-71aa), His-KSI-tagged | +Inquiry |
RFL10292RF | Recombinant Full Length Rat 3-Oxo-5-Alpha-Steroid 4-Dehydrogenase 2(Srd5A2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRD5A2-1480HCL | Recombinant Human SRD5A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRD5A2 Products
Required fields are marked with *
My Review for All SRD5A2 Products
Required fields are marked with *