|
Cat. No. |
IFNA2-009N |
|
Product
Overview |
This protein is
produced in an expression system using Nicotiana sp. plants as
an expression host |
|
Description |
At least 23
different variants of IFN-alpha are known. The individual
proteins have molecular masses between 19-26 kDa and consist of
proteins with lengths of 156-166 and 172 amino acids. All IFN-alpha
subtypes possess a common conserved sequence region between
amino acid positions 115-151 while the amino-terminal ends are
variable. Many IFN-alpha subtypes differ in their sequences at
only one or two positions. Naturally occurring variants also
include proteins truncated by 10 amino acids at the carboxy-terminal
end. |
|
Formulation |
Lyophilized
power, containing 80% SDS. |
|
Purity |
Purity is
assessed by SDS PAGE followed by Silver Stain Detection or
Western blot analysis and by Capillary Electrophoresis using a
2100 Bioanalyzer. |
|
Quality
analysis |
Gel and
capillary electrophoresis for estimation of purity. Mass
spectrometry of tryptic digest products for identity
determination. |
|
Amino acid
sequence |
The sequence of
the first twelve N-terminal amino acids was determined and was
found to be Cys-Asp-Leu-Pro-Gln-Thr-His-Ser-Leu-Gly-Ser-Arg,
conforming to the sequence of native human-IFα-2a. Other protein
fragments detected by mass spectroscopy of tryptic digestion
are highlighted in red on the following sequence representation.
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQ
QIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQ
RITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
|
Endotoxin |
< 0.0005 EU/µg
by LAL test. |
|
Biological
Activity |
IFN-alpha 2a is
fully biologically active when compared to standard. The
specific activity was determined by a quantitative gene reported
bioassay using human Type I interferon-sensitive cells. Compared
with other recombinant IFα-2a, assayed in the same conditions,
IFN-alpha 2a showed 6.1 × 108 Units/mg in reference to a viral
resistance assay using bovine kidney MDBK cells. |
|
Storage |
Product is presented as a
lyophilized powder stable at 4oC.
Adding 1 ml of distilled water to 1 mg of lyophilized powder
gives a solution of 0.2 mg/ml of IFN Alpha-2a. After
reconstitution in appropriate buffer aliquots should be stored
at -70oC.
|
|
Gene
Information
|
Gene Name |
IFNA2 interferon, alpha 2 [ Homo sapiens ] |
|
Official Symbol |
INFA2 |
|
Synonyms
|
IFNA; INFA2;
MGC125764; MGC125765; Leukocyte interferon; B cell interferon,
Type I interferon; IFNA2; IFN-α 2a; Interferon alpha-A; LeIF A;
Interferon alpha-2; Interferon alpha-2 Precursor;
interferon, alpha 2 |
|
GeneID |
3440 |
|
mRNA Refseq |
NM_000605 |
|
Protein Refseq |
NP_000596 |
|
MIM |
147562 |
|
UniProt ID |
P01563 |
|
Chromosome
Location |
9p22 |
|
Function |
interferon-alpha/beta receptor binding |
|
|
Download Datasheet:
|
|