Recombinant Human GHSR
Cat.No. : | GHSR-29024TH |
Product Overview : | Recombinant full length Human Ghrelin Receptor, Isoform 1B with N terminal proprietary tag, 57.86kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. Mutations in this gene are associated with autosomal idiopathic short stature. |
Protein length : | 289 amino acids |
Molecular Weight : | 57.860kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Pituitary and hypothalamus. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPA PLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNL YLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRV KLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRP TEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW RRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPI LSLCLLPSL |
Sequence Similarities : | Belongs to the G-protein coupled receptor 1 family. |
Gene Name : | GHSR growth hormone secretagogue receptor [ Homo sapiens ] |
Official Symbol : | GHSR |
Synonyms : | GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1; |
Gene ID : | 2693 |
mRNA Refseq : | NM_004122 |
Protein Refseq : | NP_004113 |
MIM : | 601898 |
Uniprot ID : | Q92847 |
Chromosome Location : | 3q26.31 |
Pathway : | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function : | G-protein coupled receptor activity; growth hormone secretagogue receptor activity; growth hormone-releasing hormone receptor activity; peptide hormone binding; receptor activity; |
Products Types
◆ Recombinant Protein | ||
GHSR-2188R | Recombinant Rat GHSR Protein, His (Fc)-Avi-tagged | +Inquiry |
GHSR-1578H | Recombinant Human GHSR Protein, His&GST-tagged | +Inquiry |
GHSR-4895H | Recombinant Human GHSR Protein, GST-tagged | +Inquiry |
GHSR-3244H | Recombinant Human GHSR Protein (Met1-Arg70), N-GST tagged | +Inquiry |
GHSR-1043HFL | Recombinant Human GHSR protein, His&Flag-tagged | +Inquiry |
◆ Assay kits | ||
Kit-1255 | GHSR U2OS β-Arrestin-1 GPCR Assay Kit | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All GHSR Products
Required fields are marked with *
My Review for All GHSR Products
Required fields are marked with *
0
Inquiry Basket