Recombinant Human MME

• Cat.No.: MME-26365TH
• Product Overview: Recombinant fragment corresponding to amino acids 145-249 of Human CD10 with an N terminal proprietary tag; Predicted MWt 37.29 kDa.

Specification

• Description: This gene encodes a common acute lymphocytic leukemia antigen that is an important cell surface marker in the diagnosis of human acute lymphocytic leukemia (ALL). This protein is present on leukemic cells of pre-B phenotype, which represent 85% of cases of ALL. This protein is not restricted to leukemic cells, however, and is found on a variety of normal tissues. It is a glycoprotein that is particularly abundant in kidney, where it is present on the brush border of proximal tubules and on glomerular epithelium. The protein is a neutral endopeptidase that cleaves peptides at the amino side of hydrophobic residues and inactivates several peptide hormones including glucagon, enkephalins, substance P, neurotensin, oxytocin, and bradykinin. This gene, which encodes a 100-kD type II transmembrane glycoprotein, exists in a single copy of greater than 45 kb. The 5 untranslated region of this gene is alternatively spliced, resulting in four separate mRNA transcripts. The coding region is not affected by alternative splicing.
• Protein length: 105 amino acids
• Molecular Weight: 37.290kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: NESAIDSRGGEPLLKLLPDIYGWPVATENWEQKYGASWTA EKAIAQLNSKYGKKVLINLFVGTDDKNSVNHVIHIDQPRL GLPSRDYYECTGIYKEACTAYVDFM
• Sequence Similarities: Belongs to the peptidase M13 family.

Gene Information

• Gene Name: MME membrane metallo-endopeptidase [ Homo sapiens ]
• Official Symbol: MME
• Synonyms: MME; membrane metallo-endopeptidase; neprilysin; CALLA; CD10; enkephalinase; NEP; neutral endopeptidase
• Gene ID: 4311
• mRNA Refseq: NM_000902
• Protein Refseq: NP_000893
• MIM: 120520
• Uniprot ID: P08473
• Chromosome Location: 3q21-q27
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Protein digestion and absorption, organism-specific biosystem
• Function: metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptide binding