Recombinant Human SERPINA6
Cat.No. : | SERPINA6-26357TH |
Product Overview : | Recombinant full length mature Human Cortisol Binding Globulin with N terminal proprietary tag; Predicted MW 68.24 kDa |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes an alpha-globulin protein with corticosteroid-binding properties. This is the major transport protein for glucorticoids and progestins in the blood of most vertebrates. The gene localizes to a chromosomal region containing several closely related serine protease inhibitors which may have evolved by duplication events. |
Protein length : | 383 amino acids |
Molecular Weight : | 68.240kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Plasma; synthesized in liver. Has also been identified in a number of glycocorticoid responsive cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MDPNAAYVNMSNHHRGLASANVDFAFSLYKHLVALSPKKN IFISPVSISMALAMLSLGTCGHTRAQLLQGLGFNLTERSE TEIHQGFQHLHQLFAKSDTSLEMTMGNALFLDGSLELLES FSADIKHYYESEVLAMNFQDWATASRQINSYVKNKTQGKI VDLFSGLDSPAILVLVNYIFFKGTWTQPFDLASTREENFY VDETTVVKVPMMLQSSTISYLHDAELPCQLVQMNYVGNGT VFFILPDKGKMNTVIAALSRDTINRWSAGLTSSQVDLYIP KVTISGVYDLGDVLEEMGIADLFTNQANFSRITQDAQLKS SKVVHKAVLQLNEEGVDTAGSTGVTLNLTSKPIILRFNQP FIIMIFDHFTWSSLFLARVMNPV |
Sequence Similarities : | Belongs to the serpin family. |
Gene Name : | SERPINA6 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6 [ Homo sapiens ] |
Official Symbol : | SERPINA6 |
Synonyms : | SERPINA6; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 6; CBG, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 6; corticosteroid-binding globulin; corticosteroid bindin |
Gene ID : | 866 |
mRNA Refseq : | NM_001756 |
Protein Refseq : | NP_001747 |
MIM : | 122500 |
Uniprot ID : | P08185 |
Chromosome Location : | 14q31-q32.1 |
Function : | serine-type endopeptidase inhibitor activity; steroid binding; |
Products Types
◆ Recombinant Protein | ||
SERPINA6-1369H | Recombinant Human SERPINA6 Protein, GST-tagged | +Inquiry |
SERPINA6-468H | Recombinant Human SERPINA6 Protein (Met1-Val405), His-AVI-tagged, Biotinylated | +Inquiry |
SERPINA6-4357P | Recombinant Pig SERPINA6 Protein | +Inquiry |
SERPINA6-4998R | Recombinant Rat SERPINA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Serpina6-4022M | Recombinant Mouse Serpina6 protein(Met1-Ala397), His-tagged | +Inquiry |
◆ Lysates | ||
SERPINA6-1910MCL | Recombinant Mouse SERPINA6 cell lysate | +Inquiry |
SERPINA6-1948HCL | Recombinant Human SERPINA6 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SERPINA6 Products
Required fields are marked with *
My Review for All SERPINA6 Products
Required fields are marked with *
0
Inquiry Basket