Recombinant Human SERPINB3
Cat.No. : | SERPINB3-31163TH |
Product Overview : | Recombinant fragment of Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 38.28 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene. |
Protein length : | 115 amino acids |
Molecular Weight : | 38.280kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Squamous cells. Expressed in some hepatocellular carcinoma (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLS GMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSS PTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
Gene Name : | SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ] |
Official Symbol : | SERPINB3 |
Synonyms : | SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A; |
Gene ID : | 6317 |
mRNA Refseq : | NM_006919 |
Protein Refseq : | NP_008850 |
MIM : | 600517 |
Uniprot ID : | P29508 |
Chromosome Location : | 18q21.3 |
Pathway : | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
Function : | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
Products Types
◆ Recombinant Protein | ||
SERPINB3-38H | Recombinant Human SERPINB3 Protein, C-6His tagged, Biotinylated | +Inquiry |
SERPINB3-1335H | Acitve Recombinant Human SERPINB3 protein(Asn2-Pro390), His-tagged | +Inquiry |
SERPINB3-2715H | Recombinant Human SERPINB3 protein(251-360 aa), C-His-tagged | +Inquiry |
SERPINB3-506H | Active Recombinant Human SERPINB3 Protein, His-tagged | +Inquiry |
SERPINB3-2685H | Recombinant Human SERPINB3 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
SERPINB3-460HCL | Recombinant Human SERPINB3 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All SERPINB3 Products
Required fields are marked with *
My Review for All SERPINB3 Products
Required fields are marked with *
0
Inquiry Basket