Recombinant Human SERPINB8
| Cat.No. : | SERPINB8-31160TH |
| Product Overview : | Recombinant full length Human SerpinB8 with a N terminal proprietary tag: predicted MW 52.73 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | The superfamily of high molecular weight serine proteinase inhibitors (serpins) regulate a diverse set of intracellular and extracellular processes such as complement activation, fibrinolysis, coagulation, cellular differentiation, tumor suppression, apoptosis, and cell migration. |
| Protein length : | 242 amino acids |
| Molecular Weight : | 52.730kDa inclusive of tags |
| Source : | Wheat germ |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALA MVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRT GTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELS FAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLV LVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKE AKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAV KE |
| Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
| Gene Name : | SERPINB8 serpin peptidase inhibitor, clade B (ovalbumin), member 8 [ Homo sapiens ] |
| Official Symbol : | SERPINB8 |
| Synonyms : | SERPINB8; serpin peptidase inhibitor, clade B (ovalbumin), member 8; PI8, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 8; serpin B8; CAP2; cytoplasmic antiproteinase 2; |
| Gene ID : | 5271 |
| mRNA Refseq : | NM_001031848 |
| Protein Refseq : | NP_001027018 |
| MIM : | 601697 |
| Uniprot ID : | P50452 |
| Chromosome Location : | 18q21.3 |
| Function : | peptidase inhibitor activity; protein binding; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
Products Types
| ◆ Recombinant Protein | ||
| SERPINB8-1005H | Recombinant Human SERPINB8 Protein, MYC/DDK-tagged | +Inquiry |
| SERPINB8-2597H | Recombinant Human SERPINB8, GST-tagged | +Inquiry |
| SERPINB8-686H | Recombinant Human serpin peptidase inhibitor, clade B (ovalbumin), member 8, His-tagged | +Inquiry |
| ◆ Lysates | ||
| SERPINB8-665MCL | Recombinant Mouse SERPINB8 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
