Recombinant Human ANAPC10 protein, GST-tagged
Cat.No. : | ANAPC10-541H |
Product Overview : | Human ANAPC10 full-length ORF ( AAH05217.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011] |
Molecular Mass : | 47.7 kDa |
AA Sequence : | MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ANAPC10 anaphase promoting complex subunit 10 [ Homo sapiens ] |
Official Symbol | ANAPC10 |
Synonyms | ANAPC10; anaphase promoting complex subunit 10; anaphase-promoting complex subunit 10; APC10; DKFZP564L0562; DOC1; cyclosome subunit 10; DKFZp564L0562; |
Gene ID | 10393 |
mRNA Refseq | NM_001256706 |
Protein Refseq | NP_001243635 |
MIM | 613745 |
UniProt ID | Q9UM13 |
◆ Recombinant Proteins | ||
ANAPC10-337H | Recombinant Human ANAPC10 Protein, His (Fc)-Avi-tagged | +Inquiry |
Anapc10-1619M | Recombinant Mouse Anapc10 Protein, Myc/DDK-tagged | +Inquiry |
ANAPC10-2092HFL | Recombinant Full Length Human ANAPC10 Protein, C-Flag-tagged | +Inquiry |
ANAPC10-8243Z | Recombinant Zebrafish ANAPC10 | +Inquiry |
ANAPC10-1845C | Recombinant Chicken ANAPC10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANAPC10-8871HCL | Recombinant Human ANAPC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANAPC10 Products
Required fields are marked with *
My Review for All ANAPC10 Products
Required fields are marked with *