Recombinant Human ARL3 protein, GST-tagged
Cat.No. : | ARL3-810H |
Product Overview : | Human ARL3 full-length ORF ( AAH09841, 1 a.a. - 182 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ADP-ribosylation factor-like 3 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL3 binds guanine nucleotides but lacks ADP-ribosylation factor activity. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 45.76 kDa |
AA Sequence : | MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARL3 ADP-ribosylation factor-like 3 [ Homo sapiens ] |
Official Symbol | ARL3 |
Synonyms | ARL3; ADP-ribosylation factor-like 3; ADP-ribosylation factor-like protein 3; ARFL3; ARF-like 3; |
Gene ID | 403 |
mRNA Refseq | NM_004311 |
Protein Refseq | NP_004302 |
MIM | 604695 |
UniProt ID | P36405 |
◆ Recombinant Proteins | ||
ARL3-6872H | Recombinant Human ADP-Ribosylation Factor-Like 3, His-tagged | +Inquiry |
ARL3-6199H | Recombinant Human ARL3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ARL3-1192HF | Recombinant Full Length Human ARL3 Protein, GST-tagged | +Inquiry |
ARL3-782R | Recombinant Rat ARL3 Protein | +Inquiry |
ARL3-26179TH | Recombinant Human ARL3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARL3-8714HCL | Recombinant Human ARL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARL3 Products
Required fields are marked with *
My Review for All ARL3 Products
Required fields are marked with *