Active Recombinant Human LIF, Fc-tagged, Biotinylated
| Cat.No. : | LIF-635H |
| Product Overview : | The recombinant human LIF-Fc fusion is expressed as a 419amino acid protein consisting of Ser23 - Phe202 region of (UniProt accession #P15018) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 23-202 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.1 - 0.2 ng/ml. Induce IL-6 secretion in M1 mouse myeloid leukemia cells. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency. |
| Molecular Mass : | Calculated molecular mass (kDa): 46.5; Estimated by SDS-PAGE under reducing condition (kDa): 60-65 (probably due to glycosylation) |
| AA Sequence : | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANG TEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGP DTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS NKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | LIF leukemia inhibitory factor [ Homo sapiens ] |
| Official Symbol | LIF |
| Synonyms | LIF; leukemia inhibitory factor; CDF; cholinergic differentiation factor; DIA; differentiation inhibitory activity; differentiation inducing factor; hepatocyte stimulating factor III; HILDA; human interleukin in DA cells; D factor; melanoma-derived LPL inhibitor; differentiation-inducing factor; hepatocyte-stimulating factor III; differentiation-stimulating factor; MLPLI; |
| Gene ID | 3976 |
| mRNA Refseq | NM_001257135 |
| Protein Refseq | NP_001244064 |
| MIM | 159540 |
| UniProt ID | P15018 |
| Chromosome Location | 22q12.2 |
| Pathway | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Direct p53 effectors, organism-specific biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem; |
| Function | cytokine activity; growth factor activity; leukemia inhibitory factor receptor binding; leukemia inhibitory factor receptor binding; receptor binding; |
| ◆ Recombinant Proteins | ||
| LIF-01M | Active Recombinant Mouse LIF protein, His-tagged | +Inquiry |
| LIF-207M | Active Recombinant Mouse LIF Protein | +Inquiry |
| Lif-65M | Active Recombinant Mouse Lif Protein (Ser24-Phe203), N-His tagged, Animal-free, Carrier-free | +Inquiry |
| Lif-719M | Active Recombinant Mouse Lif, His-tagged, Biotinylated | +Inquiry |
| Lif-733R | Recombinant Rat Lif protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIF-1729MCL | Recombinant Mouse LIF cell lysate | +Inquiry |
| LIF-1071HCL | Recombinant Human LIF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIF Products
Required fields are marked with *
My Review for All LIF Products
Required fields are marked with *



