Recombinant Human AK4, His-tagged

Cat.No. : AK4-26525TH
Product Overview : Recombinant full length Human AK3L1 (amino acids 1-223) with an N terminal His tag; 243 amino acids with tag, Predicted MWt 27.4 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 223 amino acids
Description : This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.
Conjugation : HIS
Molecular Weight : 27.400kDa inclusive of tags
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
Sequence Similarities : Belongs to the adenylate kinase family.
Gene Name AK4 adenylate kinase 4 [ Homo sapiens ]
Official Symbol AK4
Synonyms AK4; adenylate kinase 4; adenylate kinase 3 , adenylate kinase 3 like 1 , AK3, AK3L1; adenylate kinase isoenzyme 4, mitochondrial;
Gene ID 205
mRNA Refseq NM_001005353
Protein Refseq NP_001005353
MIM 103030
Uniprot ID P27144
Chromosome Location 1p31.3
Pathway Metabolic pathways, organism-specific biosystem; Purine metabolism, organism-specific biosystem; Purine metabolism, conserved biosystem;
Function ATP binding; GTP binding; adenylate kinase activity; nucleotide binding; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AK4 Products

Required fields are marked with *

My Review for All AK4 Products

Required fields are marked with *

0
cart-icon
0
compare icon