Recombinant Human NDUFA10, His-tagged

• Cat.No.: NDUFA10-28707TH
• Product Overview: Recombinant fragment, corresponding to amino acids 171-355 of Human NDUFA10 with N terminal His tag; MWt 24kDa

Specification

• Description: The protein encoded by this gene belongs to the complex I 42kDA subunit family. Mammalian complex I is the first enzyme complex in the electron transport chain of mitochondria. It is composed of 45 different subunits. This protein is a component of the hydrophobic protein fraction and has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitution with 65 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: EAMYNQGFIRKQCVDHYNEVKSVTICDYLPPHLVIYIDVP VPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPE MSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGPWLKQ DNRTLYHLRLLVQDKFEVLNYTSIPIFLPEVTIGAHQTDR VLHQFRELPGRKYSPGYNTEVGDKWIWLK
• Protein length: 171-355

Gene Information

• Gene Name: NDUFA10 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa [ Homo sapiens ]
• Official Symbol: NDUFA10
• Synonyms: NDUFA10; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10, 42kDa; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 10 (42kD); NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial; CI 42k; complex I 42kDa subunit
• Gene ID: 4705
• mRNA Refseq: NM_004544
• Protein Refseq: NP_004535
• MIM: 603835
• Uniprot ID: O95299
• Chromosome Location: 2q37.3
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem
• Function: ATP binding; NADH dehydrogenase (ubiquinone) activity; phosphotransferase activity, alcohol group as acceptor

Reviews

06/18/2021

What truly distinguishes the NDUFA10 Protein is the unparalleled technical support provided by the manufacturer.

09/16/2019

I highly recommend the NDUFA10 Protein to fellow researchers seeking a high-quality protein that not only meets their experimental requirements but is also accompanied by exceptional technical support.

11/04/2018

The NDUFA10 Protein's consistent stability and robust performance make it an indispensable tool for studying its multifaceted roles and mechanisms within vital biochemical pathways and cellular processes.

Q&As

Can NDUFA10 mutations be passed on to future generations?

Yes, NDUFA10 mutations can be inherited, and genetic counseling is important for families affected by these mutations.

How can NDUFA10 research contribute to drug discovery for mitochondrial diseases?

By elucidating the role of NDUFA10 in mitochondrial function, research can identify potential drug targets and pathways for therapeutic intervention.

How is NDUFA10 protein expression assessed in clinical settings?

Immunohistochemistry and western blotting techniques can be used to assess NDUFA10 protein expression in patient samples.

Are there any animal models for studying NDUFA10-related diseases?

Yes, animal models such as mouse models with NDUFA10 mutations are used to study the pathology and potential treatments for these diseases.

Is there a correlation between NDUFA10 mutations and specific clinical outcomes?

The specific type and location of NDUFA10 mutations can influence the severity and clinical manifestations of mitochondrial diseases.