Recombinant Human ZNF461 Protein, GST-tagged

Cat.No. : ZNF461-4911H
Product Overview : Human GIOT-1 partial ORF ( NP_694989.2, 121 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 121-218 a.a.
Description : ZNF461 (Zinc Finger Protein 461) is a Protein Coding gene. Among its related pathways are Gene Expression. GO annotations related to this gene include nucleic acid binding and transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZFP30.
Molecular Mass : 36.52 kDa
AA Sequence : ELSQWVNMEEFKSHSPERSIFSAIWEGNCHFEQHQGQEEGYFRQLMINHENMPIFSQHTLLTQEFYDREKISECKKCRKIFSYHLFFSHHKRTHSKEL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ZNF461 zinc finger protein 461 [ Homo sapiens ]
Official Symbol ZNF461
Synonyms ZNF461; zinc finger protein 461; GIOT 1; MGC33911; gonadotropin inducible transcription repressor 1; gonadotropin-inducible ovary transcription repressor 1; GIOT1; GIOT-1;
Gene ID 92283
mRNA Refseq NM_153257
Protein Refseq NP_694989
MIM 608640
UniProt ID Q8TAF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ZNF461 Products

Required fields are marked with *

My Review for All ZNF461 Products

Required fields are marked with *

0
cart-icon