"CDH2" Related Products

Expand
Expand

Recombinant Human CDH2 protein, GST-tagged

Cat.No.: CDH2-4938H
Product Overview: Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: GST
Form: Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass: 39 kDa
Protein length: 421 - 535 aa
AA Sequence: RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT
Purity: > 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage: Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name: CDH2 cadherin 2, type 1, N-cadherin (neuronal) [ Homo sapiens ]
Official Symbol: CDH2
Synonyms: CDH2; cadherin 2, type 1, N-cadherin (neuronal); NCAD; cadherin-2; CD325; CDHN; N cadherin; N-cadherin 1; neural cadherin; neural-cadherin; cadherin 2, N-cadherin (neuronal); calcium-dependent adhesion protein, neuronal; CDw325;
Gene ID: 1000
mRNA Refseq: NM_001792
Protein Refseq: NP_001783
MIM: 114020
UniProt ID: P19022
Chromosome Location: 18q12.1
Pathway: Adherens junctions interactions, organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; CDO in myogenesis, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem;
Function: RPTP-like protein binding; alpha-catenin binding; beta-catenin binding; calcium ion binding; gamma-catenin binding; protein kinase binding; protein phosphatase binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.