Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human CDH2 protein, GST-tagged

Recombinant Human CDH2 protein, GST-tagged

   Share
"CDH2" Related Products.
By Species
Chicken(1)
Human(12)
Mouse(7)
Rat(5)
Zebrafish(1)
By Source
+Expand -Collapse
By Tag
Fc(3)
GST(1)
His(7)
N/A(1)
Cat.No.:
CDH2-4938H
Product Overview:
Recombinant Human CDH2(421 - 535 aa) fused with GST tag at N-terminal was expressed in E. coli.
Source:
E. coli
Species:
Human
Tag:
GST
Form:
Protein lyophilized in sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, 100 mM GSH, pH 8.0). Trehalose (5-8%) and mannitol (5-8%) protectants were added before lyophilization.
Molecular Mass:
39 kDa
Protein length:
421 - 535 aa
AA Sequence:
RISGGDPTGRFAIQTDQNSNDGLVTVVKPIDFEANRMFVLTVAAENQVPLAKGIQHPPQSTATMSVTVIDVNENP YFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYT
Purity:
> 75%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability:
Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
Storage:
Short-term storage: Store at 2-8 centigrade for two weeks.Long-term storage: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.