"CLIC3" Related Products

Expand
Expand

Recombinant Human CLIC3 protein, T7-tagged

Cat.No.: CLIC3-155H
Product Overview: Recombinant human CLIC3 (236 aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMAETKLQLFVKASEDGESVGHCPSCQRLFMVLLLKGVPFTLTTVDTRRSPDVLKDFAPGS QLPILLYDSDAKTDTLQIEDFLEETLGPPDFPSLAPRYRESNTAGNDVFHKFSAFIKNPVPAQDEALYQQLLRAL ARLDSYLRAPLEHELAGEPQLRESRRRFLDGDRLTLADCSLLPKLHIVDTVCAHFRQAPIPAELRGVRRYLDSAM QEKEFKYTCPHSAEILAAYRPAVHPR
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: CLIC3 chloride intracellular channel 3 [ Homo sapiens ]
Official Symbol: CLIC3
Synonyms: CLIC3; chloride intracellular channel 3; chloride intracellular channel protein 3;
Gene ID: 9022
mRNA Refseq: NM_004669
Protein Refseq: NP_004660
MIM: 606533
UniProt ID: O95833
Chromosome Location: 9q34.3
Function: chloride channel activity; protein binding; voltage-gated chloride channel activity; voltage-gated ion channel activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.