"IQGAP2" Related Products

Recombinant Human IQGAP2 protein, GST-tagged

Cat.No.: IQGAP2-24H
Product Overview: Recombinant Human IQGAP2(343 a.a. - 449 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a member of the IQGAP family. The protein contains three IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 37.51 kDa
AA Sequence: MYQNELFNLQKQNTMNYLAHEELLIAVEMLSAVALLNQALESNDLVSVQNQLRSPAIGLNNLDKAYVERYANTLL SVKLEVLSQGQDNLSWNEIQNCIDMVNAQIQE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: IQGAP2 IQ motif containing GTPase activating protein 2 [ Homo sapiens ]
Official Symbol: IQGAP2
Synonyms: IQGAP2; IQ motif containing GTPase activating protein 2; ras GTPase-activating-like protein IQGAP2;
Gene ID: 10788
mRNA Refseq: NM_006633
Protein Refseq: NP_006624
MIM: 605401
UniProt ID: Q13576
Chromosome Location: 5q13.3
Pathway: G13 Signaling Pathway, organism-specific biosystem; Regulation of actin cytoskeleton, organism-specific biosystem; Regulation of actin cytoskeleton, conserved biosystem; TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem;
Function: GTPase inhibitor activity; Ras GTPase activator activity; actin binding; calmodulin binding;
Products Types ◆ Recombinant Protein

Related Gene

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.