Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human KHK protein, His-tagged

Recombinant Human KHK protein, His-tagged

   Share
"KHK" Related Products.
By Species
Human(11)
Mouse(4)
Rat(3)
Zebrafish(1)
By Source
+Expand -Collapse
By Tag
His(6)
MYC/DDK(1)
N/A(1)
T7(2)
Cat.No.:
KHK-493H
Product Overview:
Recombinant Human KHK(Met1-Val298) fused with His tag at C-terminal was expressed in HEK293.
Description:
Ketohexokinase, also known as Hepatic fructokinase, is a member of the carbohydrate kinase PfkB family. It exits as a homodimer and most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.This enzyme catalyzes conversion of fructose to fructose-1-phosphate. It is the first enzyme with a specialized pathway that catabolizes dietary fructose. Defects in KHK are the cause of fructosuria.
Source:
HEK293
Species:
Human
Tag :
His
Form:
Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,50nM KCl,10%Glycerol,pH7.4.
Protein length:
Met1-Val298
AA Sequence:
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTILSLLGAPCAFMGSMAP GHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDL TQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDV AKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTF NASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIVVDHHHHHH
Endotoxin:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Storage:
Store at < -20 centigrade, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Shipping:
The product is shipped on dry ice/ice packs.


Online Inquiry    
Fill in the phone number to get a $5 coupon!
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.