"LIN28A" Related Products

Expand
Expand

Recombinant Human LIN28A protein, Arginine-tagged

Cat.No.: LIN28A-129H
Product Overview: Recombinant human Lin28-11R protein fused with 11 arginine domain at C-terminal, which will efficiently deliver protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MGSVSNQQFAGGCAKAAEEAPEEAPEDAARAADEPQLLHGAGICKWFNVRMGFGFLSMTARAGVALDPPVDVFVH QSKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCIGSERRPKGKSMQKRRSKGDRCYNCGGLDHHAK ECKLPPQPKKCHFCQSISHMVASCPLKAQQGPSAQGKPTYFREEEEEIHSPTLLPEAQNESGGGGSPGRRRRRRR RRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for enhancing PiPS generation efficiency.2. Active protein, may be used for RNA/Protein binding assay.3. As specific protein substrate for kinase assay or other in vitro assay.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days
Gene Name: LIN28A lin-28 homolog A (C. elegans) [ Homo sapiens ]
Official Symbol: LIN28A
Synonyms: LIN28A; protein lin-28 homolog A; CSDD1; FLJ12457; LIN 28; ZCCHC1; RNA-binding protein LIN-28; zinc finger, CCHC domain containing 1; LIN28; LIN-28; lin-28A;
Gene ID: 79727
mRNA Refseq: NM_024674
Protein Refseq: NP_078950
MIM: 611043
UniProt ID: Q9H9Z2
Chromosome Location: 1p35.3
Function: DNA binding; RNA binding; mRNA binding; metal ion binding; miRNA binding; protein binding; translation initiation factor binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.