Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human MATN3 protein, T7/His-tagged

Recombinant Human MATN3 protein, T7/His-tagged

   Share
"MATN3" Related Products.
By Species
Chicken(1)
Human(3)
Mouse(2)
Rat(2)
By Source
+Expand -Collapse
By Tag
His(4)
T7/His(1)
Cat.No.:
MATN3-103H
Product Overview:
Recombinant human Matrillin-3 cDNA (29 - 486aa, derived from BC139907) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Description:
Human Matrillin-3 (MATN3) gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. MATN3 protein contains two von Willebrand factor A domains; it is present in the cartilage extracellular matrix and has a role in the development and homeostasis of cartilage and bone. Mutations in this gene result in multiple epiphyseal dysplasia.
Source:
E. coli
Species:
Human
Tag:
T7/His
Form:
0.4 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence:
MASMTGGQQMGRGHHHHHHENLYFQGGEFGSDPVARPGFRRLETRGPGGSPGRRPSPAAPDGAPASGTSEPGRAR GAGVCKSRPLDLVFIIDSSRSVRPLEFTKVKTFVSRIIDTLDIGPADTRVAVVNYASTVKIEFQLQAYTDKQSLK QAVGRITPLSTGTMSGLAIQTAMDEAFTVEAGAREPSSNIPKVAIIVTDGRPQDQVNEVAARAQASGIELYAVGV DRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCALDPCVLGTHQCQHVCISDGEGKHHCECSQGYTL NADKKTCSALDRCALNTHGCEHICVNDRSGSYHCECYEGYTLNEDRKTCSAQDKCALGTHGCQHICVNDRTGSHH CECYEGYTLNADKKTCSVRDKCALGSHGCQHICVSDGAASYHCDCYPGYTLNEDKKTCSATEEARRLVSTEDACG CEATLAFQDKVSSYLQRLNTKLDDILEKLKINEYGQIHR
Purity:
>90% by SDS-PAGE
Applications:
1. May be used for in vitro MATN3 mediated osteoblast differentiation pathway regulation study for cartilage formation with this protein either as soluble factor or as coating matrix protein.2. May be used for protein-protein interaction mapping.3. Potential biomarker protein for clinical monitoring NK cell function in vitro.4. As immunogen for specific antibody production.
Storage:
Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.