"NAGK" Related Products

Expand

Recombinant Human NAGK protein, T7-tagged

Cat.No.: NAGK-146H
Product Overview: Recombinant human NAGK (19 - 419aa) fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence: MASMTGGQQMGRGEFMRTRTGSQLAAREVTGSGAVPRQLEGRRCQAGRDANGGTSSDGSSSMAAIYGGVEGGGTR SEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKAGVDPLVPLRSLGLSLSGGDQEDAGRILIE ELRDRFPYLSESYLITTDAAGSIATATPDGGVVLISGTGSNCRLINPDGSESGCGGWGHMMGDEGSAYWIAHQAV KIVFDSIDNLEAAPHDIGYVKQAMFHYFQVPDRLGILTHLYRDFDKCRFAGFCRKIAEGAQQGDPLSRYIFRKAG EMLGRHIVAVLPEIDPVLFQGKIGLPILCVGSVWKSWELLKEGFLLALTQGREIQAQNFFSSFTLMKLRHSSALG GASLGARHIGHLLPMDYSANAIAFYSYTFS
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro NAGK mediated protein glycosylation modification study with this protein.2. As soluble / native protein, may be used as enzymatic substrate protein for kinase and ubiquitin assay development.3. May be used for mapping NAGK protein-protein interaction.4. May be used as antigen for specific antibody development.
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: NAGK N-acetylglucosamine kinase [ Homo sapiens ]
Official Symbol: NAGK
Synonyms: NAGK; N-acetylglucosamine kinase; N-acetyl-D-glucosamine kinase; GNK; glcNAc kinase; HSA242910;
Gene ID: 55577
mRNA Refseq: NM_017567
Protein Refseq: NP_060037
MIM: 606828
UniProt ID: Q9UJ70
Chromosome Location: 2p24.3-p24.1
Pathway: Amino sugar and nucleotide sugar metabolism, organism-specific biosystem; Amino sugar and nucleotide sugar metabolism, conserved biosystem; N-acetylglucosamine degradation II, organism-specific biosystem;
Function: ATP binding; N-acetylglucosamine kinase activity; N-acylmannosamine kinase activity; kinase activity; nucleotide binding; protein binding; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.