Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human PRSS1 protein, Fc/His-tagged

Recombinant Human PRSS1 protein, Fc/His-tagged

   Share
"PRSS1" Related Products.
By Species
By Source
+Expand -Collapse
By Tag
Fc/His(1)
His(5)
Cat.No.:
PRSS1-5894H
Product Overview:
Recombinant Human PRSS1(Ala16-Ser247) fused with Fc/His tag at C-terminal was expressed in HEK293.
Description:
Trypsin-1, also known as Beta-trypsin, Cationic trypsinogen, Serine protease 1, Trypsin I, TRP1, TRY1, TRY4, TRYP1 and PRSS1, is a member of the trypsin family of serine proteases. PRSS1 contains one peptidase S1 domain and binds one calcium ion per subunit. PRSS1 is secreted by the pancreas and cleaved to its active form in the small intestine. Trypsin-1 is active on peptide linkages involving the carboxyl group of lysine or arginine. Defects in PRSS1 are a cause of pancreatitis (PCTT), which characterized by the presence of calculi in pancreatic ducts.
Source:
HEK293
Species:
Human
Tag:
Fc/His
Form:
Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Molecular Mass:
52.9 kDa
Protein length:
Ala16-Ser247
AA Sequence:
APFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINA AKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAP VLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWI KNTIAANSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Endotoxin:
Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity:
Greater than 95% as determined by reducing SDS-PAGE.
Storage:
Please minimize freeze-thaw cycles.
Reconstitution:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.