Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human Papillomavirus HPV11 protein, GST-tagged

Recombinant Human Papillomavirus HPV11 protein, GST-tagged

   Share
"HPV11" Related Products.
By Species
By Source
E. coli(1)
By Tag
GST(1)
Cat.No.:
HPV11-250P
Product Overview:
Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
Description:
Human papillomaviruses (HPVs) are a group family with more than 150 related viruses. HP 6 and 11 considered as low-risk HPVs can be sexually transmitted, causing warts to emerge on or around the genitals or anus, known as condylomata acuminate. HPV 11 major/large capsid antigen is used in clinical diagnosis to test the specific antibody to this virus induced by the virus infection, the positive reaction of this antibody is deemed as a marker for present and past infection. Furthermore, HPV 11 large capsid is used as a potential candiadate for vaccine development.
Source:
E. coli
Species:
Human Papillomavirus
Tag :
GST
Form:
Sterile filtered clear liquid formulation. Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.
Molecular Mass:
84kDa
AA sequence:
VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDD
VENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMF
ARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSA
EVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
Purity:
Protein is >90% pure as determined by 10% PAGE (coomassie staining).
Applications:
Each laboratory should determine an optimum working titer for use in its particular application.
Usage:
The products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability:
Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C.
Please prevent freeze thaw cycles.
Shipping:
Ice Packs


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.