"RBP2" Related Products

Expand
Expand

Recombinant Human RBP2 protein, GST-tagged

Cat.No.: RBP2-19H
Product Overview: Recombinant Human RBP2(1 a.a. - 134 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Source: Wheat Germ
Species: Human
Tag : GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 42.1 kDa
Protein length: 1 a.a. - 134 a.a.
AA Sequence: MTRDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: RBP2 retinol binding protein 2, cellular [ Homo sapiens ]
Official Symbol: RBP2
Synonyms: RBP2; retinol binding protein 2, cellular; retinol-binding protein 2; CRABP II; CRBP2; CRBPII; RBPC2; CRBP-II; cellular retinol-binding protein II; retinol-binding protein 2, cellular; CRABP-II;
Gene ID: 5948
mRNA Refseq: NM_004164
Protein Refseq: NP_004155
MIM: 180280
UniProt ID: P50120
Chromosome Location: 3q23
Pathway: Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Metabolism of steroid hormones and vitamins A and D, organism-specific biosystem; Regulation of retinoblastoma protein, organism-specific biosystem; Vitamin A and carotenoid metabolism, organism-specific biosystem; Vitamin A uptake in enterocytes, organism-specific biosystem; Vitamin digestion and absorption, organism-specific biosystem;
Function: lipid binding; retinal binding; retinoid binding; retinol binding; transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.