Active Recombinant Human EIF4G1 protein, Myc/DDK-tagged

• Cat.No.: EIF4G1-01H
• Product Overview: Recombinant Human EIF4G1 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Pathways: Viral myocarditis

Specification

• Description: The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
• Source: HEK293T
• Species: Human
• Tag: Myc/DDK
• Form: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bio-activity: In vitro translation assay
• Molecular Mass: 154.6 kDa
• AA Sequence: myc-FLAG tag
• Product-Related Proteins: TA50011-100
  LC417630
  RC212877
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Usage: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL

Gene Information

• Gene Name: EIF4G1 eukaryotic translation initiation factor 4 gamma 1 [ Homo sapiens (human) ]
• Official Symbol: EIF4G1
• Synonyms: EIF-4G1; EIF4F; EIF4G; EIF4GI; P220; PARK18
• Gene ID: 1981
• mRNA Refseq: NM_004953
• Protein Refseq: NP_004944
• MIM: 600495
• UniProt ID: Q04637