Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Active Recombinant Mouse Defb3 Protein (41 aa)

Cat.No. : Defb3-037D
Product Overview : Recombinant Mouse Defb3 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Beta defensin 3, also known as BD-3 and DEFB-3, is a membrane active cationic peptide that functions in inflammation and innate immune responses and coded by Defb 3 gene on chromosome 8 in mouse. There are at least 30 β-defensins which are distinguished from α-defensins by the connectivity pattern of their three intramolecular disulfide bonds. BD3 is widely expressed among epithelial tissues, notably by keratinocytes and airway epithelial cells. It is upregulated in response to proinflammatory cytokines, microbial and viral infections, and at the edges of skin wounds. BD3 induction in osteoarthritis chondrocytes promotes MMP1 and 13 productions and inhibits TIMP1 and 2 expressions.
Source : E. coli
Species : Mouse
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Exhibits antimicrobial activity against gram-positive bacteria S. aureus and gram-negative P. aeruginosa and E. coli.
Molecular Mass : Approximately 4.6 kDa, a single non-glycosylated polypeptide chain containing 41 amino acid residues.
Protein Length : 41
AA Sequence : KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK
Endotoxin : Less than 1 EU/μg of rMuBD-3 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions
Gene Name : Defb3 defensin beta 3 [ Mus musculus (house mouse) ]
Official Symbol : Defb3
Synonyms : Defb3; defensin beta 3; BD-3; beta-defensin 3
Gene ID : 27358
mRNA Refseq : NM_013756
Protein Refseq : NP_038784
UniProt ID : Q9WTL0

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All Defb3 Products

Required fields are marked with *

My Review for All Defb3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends