Recombinant Cyan Fluorescent Protein, His-tagged

Cat.No.: CFP-2906
Product Overview: The recombinant CFP (Cyan Fluorescent Protein) is expressed in E. coli with an N-terminal His tag and purified by a method that ensures high purity and maximal CFP fluorescence.
Source: E. coli
Tag: His
Form: Freeze dried
Molecular Mass: 31.3kDa
AA Sequence: MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARY PEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISD NVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLE SFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR
Endotoxin: <0.1>
Purity: ≥97% by SDS-PAGE and HPLC
Applications: Use as standards for SDS-PAGE, Western blot analysis of CFPtransfected cells, label other proteins, calibration of fluorometers and flow cytometers,fluorescence microscope, or microinjection of CFP into cells and tissues, etc.
Storage: -80 centigrade for long-term storage.
Reconstitution: Reconstitute with dH2O to 1 mg/ml

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.