Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Beta - Amyloid (1 - 40)

Cat.No. : APP-1191H
  • Specification
  • Gene Information
  • Related Products
Cat. No. : APP-1191H
Description : β-Amyloid (1-40) together with β-Amyloid (1-42) are two major C-terminal variants of the β-Amyloid protein constituting the majority of β-Amyloids. These undergo post-secretory aggregation and deposition in the Alzheimer's disease brain. This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Sequence : H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly -Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH (3-letter code) DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV (1-letter code)
Purity : Peak Area By HPLC ≥ 95%
Molecular Weight : 4329.9
Form : Lyophilized
Reconstitution : Use 1.0% NH4OH as the solvent, followed by buffer (i.e.1XPBS). Add 1.0% NH4OH directly to the Lyophilized peptide powder (add 35-40 μl to 0.5 mgpeptide or 70-80 μl to 1 mg peptide). The peptide cannot be stored long term in 1.0% NH4OH, and it is therefore important to immediately dilute this solutionwith 1X PBS or other buffer to a concentration of approximately 1mg/mL or less.Gently vortex to mix.
Storage : Peptide is shipped at ambient temperature. Upon receipt, store lyophilized powder at -20°C or lower. Reconstituted peptide should be aliquoted into several freezer vials and stored at -20°C or lower. Do not freeze thaw.
OfficialSymbol : APP
Gene Name : APP amyloid beta (A4) precursor protein [ Homo sapiens ]
Synonyms : amyloid beta (A4) precursor protein ; APP; AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; CTFgamma ; preA4; protease nexin-II; peptidase nexin-II; beta-amyloid peptide; alzheimer disease amyloid protein; cerebral vascular amyloid peptide
Gene ID : 351
mRNA Refseq : NM_000484
Protein Refseq : NP_000475
MIM : 104760
UniProt ID : P05067
Chromosome Location : 21q21
Pathway : Activated TLR4 signaling; Alzheimer''s disease; Caspase cascade in apoptosis
Function : DNA binding; DNA binding; acetylcholine receptor binding

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends