Recombinant Aeuquorea Victoria EGFP, His-tagged
Cat.No. : | EGFP-111A |
Product Overview : | Recombinant Aeuquorea Victoria EGFP, fused with his tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
Description : | FUNCTION: Energy-transfer acceptor. Its role is to transduce the blue chemiluminescence of the protein aequorin into green fluorescent light by energy transfer. Fluoresces in vivo upon receiving energy from the Ca(2+)-activated photoprotein aequorin. BIOPHYSICOCHEMICAL PROPERTIES: Excitation max (nm): 488; Emission max (nm): 509; Extinction coefficient (Cm-1M-1): 61000. SUBUNIT: Monomer. TISSUE SPECIFICITY: Photocytes. PTM: Contains a chromophore consisting of modified amino acid residues. The chromophore is formed by autocatalytic backbone condensation between Xaa-N and Gly-(N+2), and oxidation of Tyr-(N+1) to didehydrotyrosine. Maturation of the chromophore requires nothing other than molecular oxygen. BIOTECHNOLOGY: Fluorescent proteins have become a useful and ubiquitous tool for making chimeric proteins, where they function as a fluorescent protein tag. Typically they tolerate N- and C-terminal fusion to a broad variety of proteins. They have been expressed in most known cell types and are used as a noninvasive fluorescent marker in living cells and organisms. They enable a wide range of applications where they have functioned as a cell lineage tracer, reporter of gene expression, or as a measure of protein-protein interactions. SIMILARITY: Belongs to the GFP family. |
Source : | E. coli |
Species : | Aeuquorea Victoria |
Tag : | His |
Form : | Lyophilised |
Molecular Mass : | ~30 kDa |
AA Sequence : | Histidine-V5 epitope fused to EGFP MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDHPFTVSK GEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK MVLLEFVTAAGITLGMDELYK |
Purity : | 92% by SDS-PAGE |
Storage : | After reconstitution, aliquot and keep at -20°C for long-term storage; for short term keep at 4°C. |
Reconstitution : | Reconstitute in 100 μl of sterile water. Centrifuge to remove any insoluble material. |
Gene Name : | EGFP protein |
Official Symbol : | EGFP |
Synonyms : | EGFP; Enhanced Green Fluorescent Protein |
Gene Name : | EGFP protein |
Official Symbol : | EGFP |
Synonyms : | EGFP; Enhanced Green Fluorescent Protein |
Products Types
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket