Native Human ALB therapeutic protein

Cat.No.: ALB-P042H
Product Overview: A diagnostic radiopharmaceutical containing iodinated I 131 albumin for intravenous imaging. Following intravenous injection, radioiodinated albumin human is uniformly distributed throughout the intravascular pool within 10 minutes; extravascular distribution takes place more slowly (2 days). Indicated for use in determinations of total blood and plasma volumes, cardiac output, cardiac and pulmonary blood volumes and circulation times
Description: Regulates the colloidal osmotic pressure of blood. It is used to increase the circulating plasma volume, thereby reducing hemoconcentrtion and blood viscosity. Also used as a transport protein that binds naturally occurring, therapeutic and toxic materials in circulation.
Species: Human
Molecular Mass: 66.5 kDa
AA Sequence: MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGEENFKALVLIAFAQYLQQCPFEDHVKLVNEVT EFAKTCVADESAENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRP EVDVMCTAFHDNEETFLKKYLYEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKLDELRDEG KASSAKQGLKCASLQKFGERAFKAWAVARLSQRFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADL AKYICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSLAADFVGSKDVCKNYAEAKDVFLGMFL YEYARRHPDYSVVLLLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLIKQNCELFEQL GEYKFQNALLVRYTKKVPQVSTPTLVEVSRNLGKVGSKCCKHPEAKRMPCAEDCLSVFLNQLCVLHEKTPV SDRVTKCCTESLVNGRPCFSALEVDETYVPKEFNAETFTFHADICTLSEKERQIKKQTALVELVKHKPKAT KEQLKAVMDDFAAFVEKCCKADDKETCFAEEGKKLV
Endotoxin: < 0.1 EU per μg of the protein
Purity: >95%
Gene Name: ALB albumin [ Homo sapiens ]
Official Symbol: ALB
Synonyms: ALB; albumin; serum albumin; albumin (32 AA); albumin (AA 34); growth-inhibiting protein 20; cell growth inhibiting protein 42; PRO0883; PRO0903; PRO1341; DKFZp779N1935;
Gene ID: 213
mRNA Refseq: NM_000477
Protein Refseq: NP_000468
UniProt ID: P02768
Chromosome Location: 4q13.3
Pathway: Bile acid and bile salt metabolism, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Hemostasis, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: DNA binding; antioxidant activity; cell surface binding; chaperone binding; copper ion binding; drug binding; drug binding; enzyme binding; fatty acid binding; fatty acid binding; metal ion binding; contributes_to oxygen binding; protein binding; pyridoxal phosphate binding; toxin binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.