Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-097-1828   Email: info@creative-biomart.com
Home > Products > Recombinant Proteins > Recombinant Human CD40, Fc Chimera

Recombinant Human CD40, Fc Chimera

   Share
"CD40" Related Products.
By Species
+Expand -Collapse
By Source
+Expand -Collapse
By Tag
Fc(11)
Fc-His(3)
Hi & Fc & Avi(1)
His(17)
His & Avi(1)
His/Fc(1)
Human(6)
N/A(3)
+Expand -Collapse
Cat. No.:
CD40-493H
Product Overview:
Recombinant Human CD40 encoding the signal peptide and extracellular domain of human CD40 (aa 1-193) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modifiedHuman 293 cells.
Description:
CD40 (TNFRSF5, CD40L Receptor) is a type I membrane protein and a member of the TNF receptor family. CD40 is expressed on B cells, monocytes, dendritic cells, endothelial cells, epithelial cells and B cell lymphomas and carcinomas. CD40 activates mulitple signalling pathways and can promote cell survival through up-regulation of the expression of genes encoding anti-apoptopic proteins.
Source:
Human 293 cells.
Amino Acid Sequence:
EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRRSSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK.
Molecular Mass:
Under reducing conditions CD40 (173aa) – Fc Chimera migrates as a broad band between 50 and 65 kDa on SDS-PAGE due to post-translational modifications, in particular glycosylation.
pI:
CD40 (173aa) – Fc Chimera separates into a number of glycoforms with an observed pI between 5.5 and 9.0 in 2D PAGE due to post-translational modifications, in particular glycosylation.
% Carbohydrate:
Purified CD40 (173aa) - Fc Chimera consists of 5 to 30% carbohydrate by weight.
Glycosylation:
CD40 (173aa) – Fc Chimera contains N-linked oligosaccharides and may contain O-linked oligosaccharides.
Purity:
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
Formulation:
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution:
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage:
Lyophilized products should be stored at 2 to 8°C.
Activity:
The ED50of CD40 (173aa) – Fc Chimera is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-097-1828
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2017 Creative Biomart. All Rights Reserved.