Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Active Recombinant Human Oncostatin M

Cat.No. : OSM-131H
Product Overview : Recombinant Human Oncostatin M was expressed in modifiedhuman 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Cat. No. : OSM-131H
Description : Oncostatin M (OSM) is a member of the IL-6 family of cytokines, which includes IL-6, IL-11, LIF, ciliary neurotrophic factor (CNTF), cardiotrophin-1 (CT-1) and cardiotropin-like cytokine. Structurally, OSM is a 196 amino acid monomeric glycoprotein with two potential N-linked glycosylation sites and five cysteine residues, four of which form disulfide bonds. OSM is a growth regulator, in particular with respect to human fibroblasts and vascular smooth muscle cells. Additionally, OSM stimulates the production of IL-6, G-CSF and GM-CSF from endothelial cells and hence plays a role in hematopoiesis and myelopoiesis. OSM mediates the differentiation of megakaryocytes, as well as the regulation of cholesterol metabolism, bone formation and wound healing. OSM has also been shown to play a role in both pro and anti-inflammatory actions. OSM may also be involved in multiple sclerosis (MS), as it is present in MS lesions in microglial cells and infiltrating leukocytes.
Source : human 293 cells.
Theoretical Sequence : AAIGSCSKE YRVLLGQLQKQ TDLMQDTSRL LDPYIRIQGLD VPKLREHCRE RP G AFPSEET LRGLGRR GFLQTLNA TLGCVLHR LADLEQRL PKAQDLER SGLNIEDL EKLQMARP NILGLRNN IYCMAQLL DNSDTAEP TKAGRGAS QPPTPTPA S D A F QRK LEGCRFL HGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR.
Molecular Mass : Oncostatin M migrates as a broad band between 25 and 40 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with unmodified Oncostatin M that has a predicted molecular mass of 23.7 kDa.
PI : Oncostatin M separates into a number of isoforms with a pI between 5.5 and 10 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Oncostatin M that has a predicted pI of 9.97.
% Carbohydrate : purified Oncostatin M consists of 0-40% carbohydrate by weight.
Glycosylation : Oncostatin M contains O-linked oligosaccharides.
Purity : >95%, as determined by SDS-PAGE and visualized by silver stain.
Formulation : When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
Reconstitution : It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
Storage : Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C.
Activity : The ED50of Oncostatin M is typically 0.25-0.50 ng/ml as measured in a cell proliferation assay using the human growth factor-dependent TF-1 cell line.
Gene Name : OSM oncostatin M [ Homo sapiens ]
Synonyms : oncostatin M; MGC20461; OSM; MGC20461
Gene ID : 5008
mRNA Refseq : NM_020530
Protein Refseq : NP_065391
MIM : 165095
UniProt ID : P13725
Chromosome Location : 22q12.2
Pathway : Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway
Function : cytokine activity; growth factor activity; oncostatin-M receptor binding

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
What is the impact of OSM on cancer development and progression, particularly in terms of tumor microenvironment modulation? 03/25/2022

OSM can influence cancer progression by altering the tumor microenvironment and affecting tumor cell behavior.

How does OSM (Oncostatin M) regulate inflammatory and immune responses in the body? 01/30/2021

OSM plays a key role in regulating inflammatory and immune responses, modulating cytokine production and immune cell activity.

How does OSM contribute to wound healing and tissue regeneration processes? 06/08/2020

OSM aids in wound healing and tissue regeneration, promoting cell growth and repair mechanisms.

What role does OSM play in the pathogenesis of autoimmune diseases like rheumatoid arthritis? 04/27/2020

OSM is implicated in autoimmune diseases, contributing to inflammation and joint damage in conditions like rheumatoid arthritis.

How does OSM influence liver fibrosis and hepatic diseases? 03/17/2020

OSM is involved in liver fibrosis, impacting the development and progression of hepatic diseases.

What are the mechanisms by which OSM modulates cellular growth, differentiation, and apoptosis? 06/22/2018

OSM regulates cellular processes like growth, differentiation, and apoptosis, affecting various tissue functions.

How do alterations in OSM expression or signaling affect cardiovascular health and disease? 02/20/2018

Changes in OSM signaling can impact cardiovascular health, influencing disease development and progression.

Customer Reviews (3)

Write a review
Reviews
11/25/2020

    Outstanding protein-protein interaction studies, vital for our projects.

    03/02/2020

      High-quality protein characterization, fundamental for our experiments.

      02/27/2019

        Expertise in peptide synthesis, accelerates our peptide-based research.

        Ask a Question for All OSM Products

        Required fields are marked with *

        My Review for All OSM Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends