Active Recombinant Human Oncostatin M
Cat.No. : | OSM-131H |
Product Overview : | Recombinant Human Oncostatin M was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Cat. No. : | OSM-131H |
Description : | Oncostatin M (OSM) is a member of the IL-6 family of cytokines, which includes IL-6, IL-11, LIF, ciliary neurotrophic factor (CNTF), cardiotrophin-1 (CT-1) and cardiotropin-like cytokine. Structurally, OSM is a 196 amino acid monomeric glycoprotein with two potential N-linked glycosylation sites and five cysteine residues, four of which form disulfide bonds. OSM is a growth regulator, in particular with respect to human fibroblasts and vascular smooth muscle cells. Additionally, OSM stimulates the production of IL-6, G-CSF and GM-CSF from endothelial cells and hence plays a role in hematopoiesis and myelopoiesis. OSM mediates the differentiation of megakaryocytes, as well as the regulation of cholesterol metabolism, bone formation and wound healing. OSM has also been shown to play a role in both pro and anti-inflammatory actions. OSM may also be involved in multiple sclerosis (MS), as it is present in MS lesions in microglial cells and infiltrating leukocytes. |
Source : | human 293 cells. |
Theoretical Sequence : | AAIGSCSKE YRVLLGQLQKQ TDLMQDTSRL LDPYIRIQGLD VPKLREHCRE RP G AFPSEET LRGLGRR GFLQTLNA TLGCVLHR LADLEQRL PKAQDLER SGLNIEDL EKLQMARP NILGLRNN IYCMAQLL DNSDTAEP TKAGRGAS QPPTPTPA S D A F QRK LEGCRFL HGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR. |
Molecular Mass : | Oncostatin M migrates as a broad band between 25 and 40 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with unmodified Oncostatin M that has a predicted molecular mass of 23.7 kDa. |
PI : | Oncostatin M separates into a number of isoforms with a pI between 5.5 and 10 in 2D PAGE due to post-translational modifications, in particular glycosylation. This compares with the unmodified Oncostatin M that has a predicted pI of 9.97. |
% Carbohydrate : | purified Oncostatin M consists of 0-40% carbohydrate by weight. |
Glycosylation : | Oncostatin M contains O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. |
Activity : | The ED50of Oncostatin M is typically 0.25-0.50 ng/ml as measured in a cell proliferation assay using the human growth factor-dependent TF-1 cell line. |
Gene Name : | OSM oncostatin M [ Homo sapiens ] |
Synonyms : | oncostatin M; MGC20461; OSM; MGC20461 |
Gene ID : | 5008 |
mRNA Refseq : | NM_020530 |
Protein Refseq : | NP_065391 |
MIM : | 165095 |
UniProt ID : | P13725 |
Chromosome Location : | 22q12.2 |
Pathway : | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway |
Function : | cytokine activity; growth factor activity; oncostatin-M receptor binding |
Products Types
◆ Recombinant Protein | ||
Osm-168O | Active Recombinant Mouse Osm Protein | +Inquiry |
OSM-3870R | Recombinant Rat OSM Protein, His (Fc)-Avi-tagged | +Inquiry |
Osm-1886R | Recombinant Rat Osm Protein, His-tagged | +Inquiry |
OSM-322O | Active Recombinant Human OSM Protein (210 aa) | +Inquiry |
OSM-31H | Recombinant Human OSM Protein | +Inquiry |
◆ Lysates | ||
OSM-1659MCL | Recombinant Mouse OSM cell lysate | +Inquiry |
OSM-1766HCL | Recombinant Human OSM cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionOSM can influence cancer progression by altering the tumor microenvironment and affecting tumor cell behavior.
OSM plays a key role in regulating inflammatory and immune responses, modulating cytokine production and immune cell activity.
OSM aids in wound healing and tissue regeneration, promoting cell growth and repair mechanisms.
OSM is implicated in autoimmune diseases, contributing to inflammation and joint damage in conditions like rheumatoid arthritis.
OSM is involved in liver fibrosis, impacting the development and progression of hepatic diseases.
OSM regulates cellular processes like growth, differentiation, and apoptosis, affecting various tissue functions.
Changes in OSM signaling can impact cardiovascular health, influencing disease development and progression.
Customer Reviews (3)
Write a reviewOutstanding protein-protein interaction studies, vital for our projects.
High-quality protein characterization, fundamental for our experiments.
Expertise in peptide synthesis, accelerates our peptide-based research.
Ask a Question for All OSM Products
Required fields are marked with *
My Review for All OSM Products
Required fields are marked with *
Inquiry Basket