"A1BG" Related Products

Expand
Expand
Expand

Recombinant Human A1BG

Cat.No.: A1BG-26035TH
Product Overview: Recombinant full length Human A1BG Isoform 2 with N terminal proprietary tag; Predicted MW 67.14 kDa
Description: The protein encoded by this gene is a plasma glycoprotein of unknown function. The protein shows sequence similarity to the variable regions of some immunoglobulin supergene family member proteins.
Protein length: 373 amino acids
Molecular Weight: 67.140kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Plasma.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPVSWITPGLKTTAVCRGVLRGVTFLLRREGDHEFLEVP EAQEDVEATFPVHQPGNYSCSYRTDGEGALSEPSATVTIE ELAAPPPPVLMHHGESSQVLHPGNKVTLTCVAPLSGVDFQ LRRGEKELLVPRSSTSPDRIFFHLNAVALGDGGHYTCRYR LHDNQNGWSGDSAPVELILSDETLPAPEFSPEPESGRALR LRCLAPLEGARFALVREDRGGRRVHRFQSPAGTEALFELH NISVADSANYSCVYVDLKPPFGGSAPSERLELHVDGPPPR PQLRATWSGAVLAGRDAVLRCEGPIPDVTFELLREGETKA VKTVRTPGAAANLELIFVGPQHAGNYRCRYRSWVPHTFES ELSDPVELLVAES
Sequence Similarities: Contains 5 Ig-like V-type (immunoglobulin-like) domains.
Gene Name: A1BG alpha-1-B glycoprotein [ Homo sapiens ]
Official Symbol: A1BG
Synonyms: A1BG; alpha-1-B glycoprotein; alpha-1B-glycoprotein;
Gene ID: 1
mRNA Refseq: NM_130786
Protein Refseq: NP_570602
MIM: 138670
Uniprot ID: P04217
Chromosome Location: 19q
Function: molecular_function;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.