"ADD2" Related Products

Expand

Recombinant Human ADD2

Cat.No.: ADD2-26138TH
Product Overview: Recombinant full length Human Adducin 2 with a N terminal proprietary tag; Predicted MW 105.93 kDa.
Description: Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described.
Protein length: 726 amino acids
Molecular Weight: 105.930kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed mainly in brain, spleen, kidney cortex and medulla, and heart. Also expressed in human umbilical vein endothelial cells, human vascular smooth muscle cells, kidney tubular cells and K562 cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MSEETVPEAASPPPPQGQPYFDRFSEDDPEYMRLRNRAAD LRQDFNLMEQKKRVTMILQSPSFREELEGLIQEQMKKGNN SSNIWALRQIADFMASTSHAVFPTSSMNVSMMTPINDLHT ADSLNLAKGERLMRCKISSVYRLLDLYGWAQLSDTYVTLR VSKEQDHFLISPKGVSCSEVTASSLIKVNILGEVVEKGSS CFPVDTTGFCLHSAIYAARPDVRCIIHLHTPATAAVSAMK WGLLPVSHNALLVGDMAYYDFNGEMEQEADRINLQKCLGP TCKILVLRNHGVVALGDTVEEAFYKIFHLQAACEIQVSAL SSAGGVENLILLEQEKHRPHEVGSVQWAGSTFGPMQKSRL GEHEFEALMRMLDNLGYRTGYTYRHPFVQEKTKHKSEVEI PATVTAFVFEEDGAPVPALRQHAQKQQKEKTRWLNTPNAY LRVNVADEVQRSMGSPRPKTTWMKADEVEKSSSGMPIRIE NPNQFVPLYTDPQEVLEMRNKIREQNRQDVKSAGPQSQLL ASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQL TDQELEEYKKEVERKKLELDGEKETAPEEPGSPAKSAPAS PVQSPAKEAETKSPLVSPSKSLEEGTKKTETSKAATTEPE TTQPEGVVVNGREEEQTAEEILSKGLSQMTTSADTDVDTS KDKTESVTSGPMSPEGSPSKSPSKKKKKFRTPSFLKKSKK KEKVES
Sequence Similarities: Belongs to the aldolase class II family. Adducin subfamily.
Gene Name: ADD2 adducin 2 (beta) [ Homo sapiens ]
Official Symbol: ADD2
Synonyms: ADD2; adducin 2 (beta); beta-adducin; ADDB;
Gene ID: 119
mRNA Refseq: NM_001185054
Protein Refseq: NP_001171983
MIM: 102681
Uniprot ID: P35612
Chromosome Location: 2p13.3
Function: actin binding; actin filament binding; calmodulin binding; metal ion binding; protein heterodimerization activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.