Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human AMBN

Recombinant Human AMBN

   Share
"AMBN" Related Products.
By Species
Human(5)
Mouse(6)
Rat(3)
By Source
+Expand -Collapse
By Tag
His(4)
Cat.No.:
AMBN-27234TH
Product Overview:
Recombinant full length Human AMBN with N terminal proprrietary tag; Predicted MW 75.24kDa.
Description:
This gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect.
Protein length:
447 amino acids
Molecular Weight:
75.240kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Ameloblast-specific. Located at the Tomes processes of secretory ameloblasts and in the sheath space between rod-interrod enamel.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQSGTPGMA SLSLETMRQLGSLQRLNTLSQYSRYGFGKSFNSLWMHGLL PPHSSLPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQ PGLKPFLQSAAATTNQATALKEALQPPIHLGHLPLQEGEL PLVQQQVAPSDKPPKPELPGVDFADPQGPSLPGMDFPDPQ GPSLPGLDFADPQGSTIFQIARLISHGPMPQNKQSPLYPG MLYVPFGANQLNAPARLGIMSSEEVAGGREDPMAYGAMFP GFGGMRPGFEGMPHNPAMGGDFTLEFDSPVAATKGPENEE GGAQGSPMPEANPDNLENPAFLTELEPAPHAGLLALPKDD IPGLPRSPSGKMKGLPSVTPAAADPLMTPELADVYRTYDA DMTTSVDFQEEATMDTTMAPNSLQTSMPGNKAQEPEMMHD AWHFQEP
Sequence Similarities:
Belongs to the ameloblastin family.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.