"ARHGAP1" Related Products

Expand

Recombinant Human ARHGAP1

Cat.No.: ARHGAP1-26235TH
Product Overview: Recombinant fragment of Human ARHGAP1 with a N terminal proprietary tag; Predicted MWt 36.63 kDa.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: GFLNIDESQRVPATLQVLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAKDAAITLKAINPINTFTKFLLDHQGELFPSPDPSGL
Sequence Similarities: Contains 1 CRAL-TRIO domain.Contains 1 Rho-GAP domain.
Gene Name: ARHGAP1 Rho GTPase activating protein 1 [ Homo sapiens ]
Official Symbol: ARHGAP1
Synonyms: ARHGAP1; Rho GTPase activating protein 1; rho GTPase-activating protein 1; Cdc42GAP; CDC42GAP; p50rhoGAP; RhoGAP;
Gene ID: 392
mRNA Refseq: NM_004308
Protein Refseq: NP_004299
MIM: 602732
Uniprot ID: Q07960
Chromosome Location: 11p11.2
Pathway: Regulation of CDC42 activity, organism-specific biosystem; Regulation of RAC1 activity, organism-specific biosystem; Rho GTPase cycle, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by Rho GTPases, organism-specific biosystem;
Function: GTPase activator activity; Rac GTPase activator activity; Rho GTPase activator activity; SH3 domain binding; SH3/SH2 adaptor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.