Recombinant Human ARL4D, His-tagged
Cat.No. : | ARL4D-27056TH |
Product Overview : | Recombinant full length Human ARF4L with N terminal His tag; 221 amino acids with tag, Predicted MWt 24.3 kDa. |
- Specification
- Gene Information
- Related Products
Description : | ADP-ribosylation factor 4D is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4D is closely similar to ARL4A and ARL4C and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in membrane-associated intracellular trafficking. Mutations in this gene have been associated with Bardet-Biedl syndrome (BBS). |
Protein length : | 201 amino acids |
Conjugation : | HIS |
Molecular Weight : | 24.300kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 1.17% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGNHLTEMAPTASSFLPHFQ ALHVVVIGLDSAGKTSLLYRLKFKEFVQSVPTKGFNTE KIRVPLGGSRGITFQVWDVGGQEKLRPLWRSYTRRTDGLV FVVDAAEAERLEEAKVELHRISRASDNQGVPVLVLANK QDQPGALSAAEVEKRLAVRELAAATLTHVQGCSAVDGLGL QQGLERLYEMILKRKKAARGGKKRR |
Sequence Similarities : | Belongs to the small GTPase superfamily. Arf family. |
Gene Name : | ARL4D ADP-ribosylation factor-like 4D [ Homo sapiens ] |
Official Symbol : | ARL4D |
Synonyms : | ARL4D; ADP-ribosylation factor-like 4D; ADP ribosylation factor 4 like , ARF4L; ADP-ribosylation factor-like protein 4D; |
Gene ID : | 379 |
mRNA Refseq : | NM_001661 |
Protein Refseq : | NP_001652 |
MIM : | 600732 |
Uniprot ID : | P49703 |
Chromosome Location : | 17q12-q21 |
Function : | GTP binding; GTPase activity; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
ARL4D-724M | Recombinant Mouse ARL4D Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4D-231R | Recombinant Rhesus Macaque ARL4D Protein, His (Fc)-Avi-tagged | +Inquiry |
ARL4D-1933M | Recombinant Mouse ARL4D Protein | +Inquiry |
ARL4D-813H | Recombinant Human ARL4D protein, GST-tagged | +Inquiry |
ARL4D-402R | Recombinant Rhesus monkey ARL4D Protein, His-tagged | +Inquiry |
◆ Lysates | ||
ARL4D-8711HCL | Recombinant Human ARL4D 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket