Address: 45-1 Ramsey Road, Shirley, NY 11967, USA    USA: 1-631-559-9269  1-631-448-7888   Fax: 1-631-938-8127  Europe: 44-207-048-3343   Email: info@creative-biomart.com
Home > Products > Antibody > Monoclonal Antibodies > Recombinant Human ARR3

Recombinant Human ARR3

   Share
"ARR3" Related Products.
By Species
Chicken(1)
Human(6)
Mouse(5)
Rat(2)
By Tag
GST(1)
His(1)
Cat.No.:
ARR3-26077TH
Product Overview:
Recombinant full length Human Arrestin C isoform 2 with N terminal proprietary tag; Predicted MWt 65.56 kDa.
Description:
Arrestin-C also known as retinal cone arrestin-3 is a protein that in humans is encoded by the ARR3 gene.
Protein length:
359 amino acids
Molecular Weight:
65.560kDa inclusive of tags
Source:
Wheat germ
Tissue specificity:
Inner and outer segments, and the inner plexiform regions of the retina.
Form:
Liquid
Purity:
Proprietary Purification
Storage buffer:
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:
MSKVFKKTSSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVD PEYFKCRKLFVMLTCAFRYGRDDLEVIGLTFRKDLYVQTL QVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNL PCSVTLQPGPEDAGKPCGIDFEVKSFCAENPEETVSKRDY VRLVVRKVQFAPPEAGPGPSAQTIRRFLLSAQPLQLQAWM DREVHYHGEPISVNVSINNCTNKVIKKIKISVDQITDVVL YSLDKYTKTVFIQEFTETVAANSSFSQSFAVTPILAASCQ KRGLALDGKLKHEDTNLASSTIIRPGMDKELLGILVSYKV RVNLMVSCGGILGDLTASDVGVELPLVLIHPKPSHEAAR
Sequence Similarities:
Belongs to the arrestin family.


Online Inquiry    
Note: There will be extra charge for optional service!
Optional requirements on this protein +Expand
C-fusion   N-fusion  Non-tagged
His   GST  Fc  Others
<1.0 eu/μg   <0.1 eu/μg  <0.01 eu/μg  Not required
Monomer Isolation   Dimer Isolation   Not required
>80% by SDS-PAGE   >90% by SDS-PAGE  >95% by SDS-PAGE  Others
Please input "biomart" as verification code.
Please review Creative Biomart's privacy policy for more information.
Price does not include shipping and packaging costs.Request quote for final price.

If you have any other questions, please call
+1-631-559-9269.

online inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

45-1 Ramsey Road, Shirley, NY 11967, USA
USA: 1-631-559-9269  1-631-448-7888
Europe: 44-207-048-3343
FAX: 1-631-938-8127
EMAIL: info@creative-biomart.com

facebook twitter linkedin google plus google plus

Join 10 other subscribers

24x7
CUSTOMER SERVICE
Easy access to products and services you need from our library via powerful searching tools
Copyright © 2007 - 2016 Creative Biomart. All Rights Reserved.