Recombinant Human BBOX1, His-tagged
Cat.No. : | BBOX1-26648TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 100-387 of Human BBOX1 with N terminal His tag; 288 amino acids, 34kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes gamma butyrobetaine hydroxylase which catalyzes the formation of L-carnitine from gamma-butyrobetaine, the last step in the L-carnitine biosynthetic pathway. Carnitine is essential for the transport of activated fatty acids across the mitochondrial membrane during mitochondrial beta-oxidation. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 92 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ARAKLQRELFFPECQYWGSELQLPTLDFEDVLRYDEHAYK WLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFY GHTWQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLL HCIKQTVTGGDSEIVDGFNVCQKLKKNNPQAFQILSST FVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNN ATRDTIFDVPVERVQPFYAALKEFVDLMNSKESKFTFKMN PGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDV VMSRLRILRQRVENGN |
Gene Name : | BBOX1 butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 [ Homo sapiens ] |
Official Symbol : | BBOX1 |
Synonyms : | BBOX1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; BBOX; gamma-butyrobetaine dioxygenase; BBH; G BBH; gamma BBH; |
Gene ID : | 8424 |
mRNA Refseq : | NM_003986 |
Protein Refseq : | NP_003977 |
MIM : | 603312 |
Uniprot ID : | O75936 |
Chromosome Location : | 11p |
Pathway : | Carnitine synthesis, organism-specific biosystem; Lysine degradation, organism-specific biosystem; Lysine degradation, conserved biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
Function : | gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; gamma-butyrobetaine dioxygenase activity; iron ion binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
Bbox1-1828M | Recombinant Mouse Bbox1 Protein, Myc/DDK-tagged | +Inquiry |
BBOX1-605R | Recombinant Rat BBOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BBOX1-2378H | Recombinant Human BBOX1 Protein, MYC/DDK-tagged | +Inquiry |
BBOX1-10149H | Recombinant Human BBOX1, His-tagged | +Inquiry |
BBOX1-2474Z | Recombinant Zebrafish BBOX1 | +Inquiry |
◆ Lysates | ||
BBOX1-001HCL | Recombinant Human BBOX1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket