Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human BIN1, His-tagged

Cat.No. : BIN1-26751TH
Product Overview : Recombinant fragment, corresponding to amino acids 96-439 of Human BIN1 with N-terminal His tag, Predicted MWt 39 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes several isoforms of a nucleocytoplasmic adaptor protein, one of which was initially identified as a MYC-interacting protein with features of a tumor suppressor. Isoforms that are expressed in the central nervous system may be involved in synaptic vesicle endocytosis and may interact with dynamin, synaptojanin, endophilin, and clathrin. Isoforms that are expressed in muscle and ubiquitously expressed isoforms localize to the cytoplasm and nucleus and activate a caspase-independent apoptotic process. Studies in mouse suggest that this gene plays an important role in cardiac muscle development. Alternate splicing of the gene results in ten transcript variants encoding different isoforms. Aberrant splice variants expressed in tumor cell lines have also been described.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous. Highest expression in the brain and muscle. Isoform IIA is expressed only in the brain where it is concentrated in axon initial segments and nodes of Ranvier. Isoform BIN1 is widely expressed with highest expression in skeletal muscle.
Form : Lyophilised:Reconstitute with 118 μl aqua dest
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GRDEANKIAENNDLLWMDYHQKLVDQALLTMDTYLGQFPD IKSRIAKRGRKLVDYDSARHHYESLQTAKKKDEAKIAK AEEELIKAQKVFEEMNVDLQEELPSLWNSRVGFYVNTF QSIAGLEENFHKEMSKLNQNLNDVLVGLEKQHGSNTFT VKAQPSDNAPAKGNKSPSPPDGSPAATPEIRVNHEPEPAG GATPGATLPKSPSQPAEASEVAGGTQPAAGAQEPGETA ASEAASSSLPAVVVETFPATVNGTVEGGSGAGRLDLPP GFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEE QDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
Sequence Similarities : Contains 1 BAR domain.Contains 1 SH3 domain.
Gene Name : BIN1 bridging integrator 1 [ Homo sapiens ]
Official Symbol : BIN1
Synonyms : BIN1; bridging integrator 1; AMPHL; myc box-dependent-interacting protein 1; AMPH2; amphiphysin II; SH3P9;
Gene ID : 274
mRNA Refseq : NM_004305
Protein Refseq : NP_004296
MIM : 601248
Uniprot ID : O00499
Chromosome Location : 2q14
Pathway : Arf6 trafficking events, organism-specific biosystem;
Function : GTPase binding; protein binding; protein heterodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends