Recombinant Human CKMT1A
Cat.No. : | CKMT1A-27115TH |
Product Overview : | Recombinant full length Human CKMT1B with N terminal proprietary tag; Predicted MWt 71.94 kDa. |
- Specification
- Gene Information
- Related Products
Description : | Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. |
Protein length : | 417 amino acids |
Molecular Weight : | 71.940kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAA SERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTT PTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFAD LFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVL SSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKG DLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGM ARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMK RVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNL GTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDT AATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRL ERGQDIRIPTPVIHTKH |
Gene Name : | CKMT1A creatine kinase, mitochondrial 1A [ Homo sapiens ] |
Official Symbol : | CKMT1A |
Synonyms : | CKMT1A; creatine kinase, mitochondrial 1A; CKMT1, creatine kinase, mitochondrial 1 (ubiquitous); creatine kinase U-type, mitochondrial; |
Gene ID : | 548596 |
mRNA Refseq : | NM_001015001 |
Protein Refseq : | NP_001015001 |
MIM : | 613415 |
Uniprot ID : | P12532 |
Chromosome Location : | 15q15 |
Pathway : | Arginine and proline metabolism, organism-specific biosystem; Arginine and proline metabolism, conserved biosystem; Creatine metabolism, organism-specific biosystem; Creatine pathway, organism-specific biosystem; Creatine pathway, conserved biosystem; |
Function : | ATP binding; creatine kinase activity; nucleotide binding; |
Products Types
◆ Recombinant Protein | ||
CKMT1A-324H | Recombinant Human CKMT1A Protein, His-tagged | +Inquiry |
CKMT1A-2155H | Recombinant Human CKMT1A Protein (Ser41-Ile250), His tagged | +Inquiry |
CKMT1A-8626H | Recombinant Human CKMT1A protein, His-tagged | +Inquiry |
CKMT1A-27113TH | Recombinant Human CKMT1A | +Inquiry |
CKMT1A-5756C | Recombinant Chicken CKMT1A | +Inquiry |
◆ Lysates | ||
CKMT1A-001HCL | Recombinant Human CKMT1A cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket