Recombinant Human CSDE1, His-tagged
Cat.No. : | CSDE1-28019TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 515-767 of Human CSDE1 Isoform 2 with N terminal His tag; Predicted MWt 29 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 132 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | YSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSV NGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVE EGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQ NAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLF FHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVC EGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPR GPDNSMGFGAERKIRQAGVID |
Gene Name : | CSDE1 cold shock domain containing E1, RNA-binding [ Homo sapiens ] |
Official Symbol : | CSDE1 |
Synonyms : | CSDE1; cold shock domain containing E1, RNA-binding; cold shock domain-containing protein E1; D1S155E; UNR; upstream of NRAS; |
Gene ID : | 7812 |
mRNA Refseq : | NM_001130523 |
Protein Refseq : | NP_001123995 |
MIM : | 191510 |
Uniprot ID : | O75534 |
Chromosome Location : | 1p13.2 |
Pathway : | Validated targets of C-MYC transcriptional repression, organism-specific biosystem; |
Function : | DNA binding; RNA binding; |
Products Types
◆ Recombinant Protein | ||
CSDE1-1958H | Recombinant Human CSDE1 Protein, GST-tagged | +Inquiry |
Csde1-2338M | Recombinant Mouse Csde1 Protein, Myc/DDK-tagged | +Inquiry |
CSDE1-1285R | Recombinant Rat CSDE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSDE1-1627R | Recombinant Rat CSDE1 Protein | +Inquiry |
CSDE1-2607C | Recombinant Chicken CSDE1 | +Inquiry |
◆ Lysates | ||
CSDE1-7249HCL | Recombinant Human CSDE1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CSDE1 Products
Required fields are marked with *
My Review for All CSDE1 Products
Required fields are marked with *
0
Inquiry Basket